{"title":"Éminence Organic Skin Care","description":"\u003cp\u003e\u003cspan\u003eDiscover the natural beauty of Éminence Organic Skin Care, handcrafted with pure, sustainably sourced ingredients. Each product is made with organic fruits, herbs, and botanicals to nourish and rejuvenate your skin.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eFrom hydrating serums to gentle cleansers and powerful masks, Éminence delivers visible results with eco-conscious formulations. Achieve radiant, healthy skin with clean, green skincare that’s as luxurious as it is effective.\u003c\/span\u003e\u003c\/p\u003e","products":[{"product_id":"eminenceorganicsacneadvancedclarifyingmasque","title":"Eminence Organics Acne Advanced Clarifying Masque","description":"\u003cp\u003eThis two-in-one mask and spot treatment utilizes potent anti-acne ingredients to treat active acne and prevent future breakouts. Three types of purifying clay combine to absorb oil and reduce shine, while basil oil helps ensure the skin looks calm and less irritated. Use it to treat the entire face and neck or as a spot treatment to restore clarity to your complexion.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eRetail Size: 2 oz\/ 60 ml\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003e Cleanse skin thoroughly before applying this product. Apply a small amount of product evenly over the entire face and neck or apply as a spot treatment as desired. Allow to dry for five to 10 minutes. Rinse thoroughly with lukewarm water and use a face cloth if desired. Use weekly as a mask, or as a spot treatment up to three times per day.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942675476639,"sku":"","price":79.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/50a-acne-advanced-clarifying-mask-v2-400pix-compressor.jpg?v=1604871078"},{"product_id":"eminenceorganicsacneadvancedcleansingfoam","title":"Eminence Organics Acne Advanced Cleansing Foam","description":"\u003cp\u003eThis unique liquid-to-foam cleanser provides lightweight acne cleansing action, effectively preventing acne breakouts and clearing blocked pores. Featuring time-release encapsulated salicylic acid combined with a natural herb blend, this cleanser soothes and tones to address the look of uneven skin.\u003c\/p\u003e\n\u003cp\u003e\u003cstrong\u003eRetail Size: 5 oz\/ 147 ml\u003c\/strong\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr\u003e Use one to three times daily. Pump a small amount of product to transform the liquid into a lightweight foam. Apply to skin and massage gently with fingertips in a circular motion covering the face and neck areas. Rinse thoroughly and pat dry.\u003c\/p\u003e\n\u003cp\u003e \u003c\/p\u003e\n\u003cp\u003e. \u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942675935391,"sku":"","price":59.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/51a-acne-advanced-cleansing-foam-v2-400pix-compressor.jpg?v=1604871152"},{"product_id":"eminence-organics-apricot-body-oil","title":"Eminence Organics Apricot Body Oil","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Seduce your senses with our luxurious Apricot Body Oil. Ultra-hydrating apricot oil is blended with an assortment of essential oils, such as grape seed and jojoba, to create a luscious massage oil that leaves skin feeling irresistibly soft and supple. \\n\\nRetail Size: 8.2 oz \/ 240 ml\\n\\n- Winner of Best Massage Oil, DaySpa Professional Choice Awards, 2019\\n- Winner of Best Massage Oil, DaySpa Professional Choice Awards, 2017\\n- Winner of Best Product, LNE's Best, Les Nouvelles Esthétiques \u0026amp; Spa\\n\\nHow to Use:\\nDispense an appropriate amount of oil for massage and warm in hands prior to application.\\n\\nTry our alternate uses:\\n\\nHydrate your skin from head to toe\\nRemedy dry hands and elbows\\nDeeply moisturize to relieve dry, flaky skin\\nAdd a drop to your favorite Eminence Organics body lotion to enhance your experience with a richer formula\\n\\nKey Ingredients:\\nApricot Kernel Oil: high in Vitamins A, C and E with skin softening properties, assists the skin in retaining the look of elasticity, clarity and suppleness\\nGrape Seed Oil: rejuvenating and restructuring qualities, moisturizes, reduces the look of lines and wrinkles\\nJojoba Oil (Biodynamic®): nourishes and hydrates with one of the best absorption rates\\nSeabuckthorn Oil: vitamin and nutrient rich; protects skin cell membrane\\nPomegranate Seed Oil: polyphenol-rich with high levels of antioxidants (even higher than green tea)\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nEpidermis is moisturized and feels revitalized\\nSkin tone appears improved\\nSkin texture appears softer and more supple\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eSeduce your senses with our luxurious Apricot Body Oil. Ultra-hydrating apricot oil is blended with an assortment of essential oils, such as grape seed and jojoba, to create a luscious massage oil that leaves skin feeling irresistibly soft and supple. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 8.2 oz \/ 240 ml\u003c\/strong\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Seduce your senses with our luxurious Apricot Body Oil. Ultra-hydrating apricot oil is blended with an assortment of essential oils, such as grape seed and jojoba, to create a luscious massage oil that leaves skin feeling irresistibly soft and supple. \\n\\nRetail Size: 8.2 oz \/ 240 ml\\n\\n- Winner of Best Massage Oil, DaySpa Professional Choice Awards, 2019\\n- Winner of Best Massage Oil, DaySpa Professional Choice Awards, 2017\\n- Winner of Best Product, LNE's Best, Les Nouvelles Esthétiques \u0026amp; Spa\\n\\nHow to Use:\\nDispense an appropriate amount of oil for massage and warm in hands prior to application.\\n\\nTry our alternate uses:\\n\\nHydrate your skin from head to toe\\nRemedy dry hands and elbows\\nDeeply moisturize to relieve dry, flaky skin\\nAdd a drop to your favorite Eminence Organics body lotion to enhance your experience with a richer formula\\n\\nKey Ingredients:\\nApricot Kernel Oil: high in Vitamins A, C and E with skin softening properties, assists the skin in retaining the look of elasticity, clarity and suppleness\\nGrape Seed Oil: rejuvenating and restructuring qualities, moisturizes, reduces the look of lines and wrinkles\\nJojoba Oil (Biodynamic®): nourishes and hydrates with one of the best absorption rates\\nSeabuckthorn Oil: vitamin and nutrient rich; protects skin cell membrane\\nPomegranate Seed Oil: polyphenol-rich with high levels of antioxidants (even higher than green tea)\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nEpidermis is moisturized and feels revitalized\\nSkin tone appears improved\\nSkin texture appears softer and more supple\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eDispense an appropriate amount of oil for massage and warm in hands prior to application.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eTry our alternate uses:\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli\u003eHydrate your skin from head to toe\u003c\/li\u003e\n\u003cli\u003eRemedy dry hands and elbows\u003c\/li\u003e\n\u003cli\u003eDeeply moisturize to relieve dry, flaky skin\u003c\/li\u003e\n\u003cli\u003eAdd a drop to your favorite Eminence Organics body lotion to enhance your experience with a richer formula\u003c\/li\u003e\n\u003c\/ul\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942754447519,"sku":"","price":39.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/55a-apricot_body_oil400pix.jpg?v=1604871843"},{"product_id":"eminence-organics-apricot-whip-moisturizer","title":"Eminence Organics Apricot Whip Moisturizer","description":"\u003cp\u003e\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Revitalize your complexion with the power of pure apricot and carrot juice, infused with healthy doses of vitamins A, B, C and D. The age-defying properties of apricot will enrich and nourish your skin, giving it the appearance of a youthful glow. \\n\\nRetail Size: 2 oz \/ 60 ml\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nApricot: revitalizing and hydrating agent with vitamins and nutrients\\nCarrot: Vitamin A, carotene oils\\nCorn Germ Oil: enriches and moisturizes the skin\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin appears visibly firmer\\nSkin texture appears soft and supple\\nMoisture levels are balanced\\nThe visible signs of aging are reduced\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eRevitalize your complexion with the power of pure apricot and carrot juice, infused with healthy doses of vitamins A, B, C and D. The age-defying properties of apricot will enrich and nourish your skin, giving it the appearance of a youthful glow. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 2 oz \/ 60 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942801731743,"sku":"","price":69.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/57a-apricot_whip_moisturizer.jpg?v=1604872137"},{"product_id":"eminence-organics-arctic-berry-peptide-radiance-cream","title":"Eminence Organics Arctic Berry Peptide Radiance Cream","description":"\u003cp\u003e\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Transform the appearance of your skin with this all-powerful daily moisturizer that features our exclusive Peptide Illuminating Complex. Reveal your radiance naturally and discover smooth, even and luminous skin. \\n\\nThe Arctic Berry Peptide Radiance Cream is part 3 of a 3-step Professional system:\\nStep 1: Arctic Berry Enzyme Exfoliant\\nStep 2: Arctic Berry Pro Advanced Peel Activator MA20\\nStep 3: Arctic Berry Peptide Radiance Cream\\n\\nAlso available is the complete at home care Arctic Berry Peel \u0026amp; Peptide Illuminating System which is great for in-between spa treatments that will awaken the skin’s natural inner beauty (includes Arctic Berry Enzyme Exfoliant, Arctic Berry Pro Advanced Peel Activator MA10 \u0026amp; Arctic Berry Peptide Radiance Cream).\\n\\nRetail Size: 2 oz \/ 60 ml\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nArctic Plants \u0026amp; Berries: a blend of 4 antioxidant-rich plants (cloudberry seed, arctic roseroot, arctic meadowsweet and juniper sprouts); helps prevent the signs of aging\\nLingonberry Seed Oil: essential vitamins and minerals and omega 3 fatty acids; replenishes the skin’s moisture\\nPeptide Illuminating Complex: antioxidant-rich mix of hibiscus seed botanical peptides, gardenia stem cells and yellow plum extract\\nHibiscus Seed Extract Peptides: promotes elasticity in the skin\\nYellow Plum: helps reduce the appearance of inflammation\\nGardenia Stem Cells: improves the appearance of skin tone and elasticity\\nGotu-Kola Stem Cells: improves hydration levels and the appearance of fine lines and wrinkles\\nBiophytex™: Dynamic blend of plant extracts which reduces the appearance of redness\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin appears smooth and wrinkles appear reduced\\nSkin appears firmed and plumped\\nThe appearance of skin irritation and inflammation is reduced\\nSkin is hydrated\\nComplexion appears more luminous, smooth and calm\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eTransform the appearance of your skin with this all-powerful daily moisturizer that features our exclusive Peptide Illuminating Complex. Reveal your radiance naturally and discover smooth, even and luminous skin. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eThe Arctic Berry Peptide Radiance Cream is part 3 of a 3-step Professional system:\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003eStep 1: Arctic Berry Enzyme Exfoliant\u003cbr data-mce-fragment=\"1\"\u003eStep 2: Arctic Berry Pro Advanced Peel Activator MA20\u003cbr data-mce-fragment=\"1\"\u003eStep 3: Arctic Berry Peptide Radiance Cream\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eAlso available is the complete at home care Arctic Berry Peel \u0026amp; Peptide Illuminating System which is great for in-between spa treatments that will awaken the skin’s natural inner beauty (includes Arctic Berry Enzyme Exfoliant, Arctic Berry Pro Advanced Peel Activator MA10 \u0026amp; Arctic Berry Peptide Radiance Cream).\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 2 oz \/ 60 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942913044639,"sku":"","price":109.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/files\/IMG-3914.jpg?v=1762172197"},{"product_id":"eminence-organics-bamboo-age-corrective-masque","title":"Eminence Organics Bamboo Age Corrective Masque","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Treat the skin with this age repairing mask that uses the most powerful anti-aging technology in natural and organic skin care.\\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\\n- Winner of the Look Great Grooming Award, Men's Fitness, 2017\\n\\nHow to Use:\\nApply a thin layer of mask with fingertips to cleansed skin, avoiding the eye area. (Dilute with water for easier application). May use galvanic or ultrasound. Leave on for 5–10 minutes. Remove with a damp face cloth.\\n\\nKey Ingredients:\\nNatural Retinol Alternative: skin appears immediately lifted and tightened; contains chicory root oligosaccharides and tara tree gum\\nPhytoCellTec™ Swiss Green Apple Stem Cells: plant stem cell concentrate; promotes elasticity and delays the visible signs of aging\\nBamboo: contains soluble and insoluble fiber, antioxidants, proteins, vitamins and minerals\\nArgan Oil: antioxidant; softens and moisturizes\\nShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin instantly looks and feels firmer and tighter\\nSigns of aging are visibly reduced\\nSkin is smoother and more toned\\nMoisture and hydration levels are improved\\nElasticity of the skin is improved\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eTreat the skin with this age repairing mask that uses the most powerful anti-aging technology in natural and organic skin care.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 2 oz \/ 60 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer of mask with fingertips to cleansed skin, avoiding the eye area. (Dilute with water for easier application). May use galvanic or ultrasound. Leave on for 5–10 minutes. Remove with a damp face cloth.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942934868127,"sku":"","price":66.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/files\/IMG-3917.jpg?v=1762172638"},{"product_id":"eminence-organics-bamboo-firming-fluid","title":"Eminence Organics Bamboo Firming Fluid","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;For tighter looking skin, our Bamboo Firming Fluid is the answer. The strengthening agents of bamboo and coconut deeply hydrates, with the help of a Natural Retinol Alternative and Swiss Green Apple Stem Cells.\\n\\nRetail Size: 1.2 oz \/ 35 ml\\n\\n- Winner of Favourite Firming Serum, Aestheticians’ Choice Awards, Dermascope, 2018\\n- Winner of Best Skin Serum, International Beauty Awards 2017, Natural Health UK, 2017\\n- Winner of Premium Organic Skin Care Product, Sister's Beauty Pro Awards, Hong Kong, 2014\\n- Winner of Best Retinol Alternative, Earth Day Beauty Awards, Healing Lifestyles \u0026amp; Spas, 2013\\n\\nHow to Use:\\nApply a thin layer of firming fluid to cleansed skin once or twice daily. Leave on. Follow with a moisturizer.\\n\\nKey Ingredients:\\nBamboo: contains soluble and insoluble fiber, antioxidants, proteins, vitamins and minerals\\nCoconut Oil: moisturizer, antioxidant; restores the skin's moisture barrier\\nCoconut Water: moisture and pH balancing, toning; contains electrolytes, vitamin C, calcium, potassium, phosphorus\\nNatural Retinol Alternative Complex: contains chicory root oligosaccharides and tara tree; smooths the appearance of wrinkles\\nPhytoCellTec™ Swiss Green Apple Stem Cells: plant stem cell concentrate; delays the appearance of visible signs of aging\\nMonoi: soothing and fragrant Tahitian oil; hydrates and firms the skin \\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin feels firmer and tighter\\nThe visible signs of aging are reduced\\nThe appearance of elasticity is improved\\nSkin appears smooth and silky\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eFor tighter looking skin, our Bamboo Firming Fluid is the answer. The strengthening agents of bamboo and coconut deeply hydrates, with the help of a Natural Retinol Alternative and Swiss Green Apple Stem Cells.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 1.2 oz \/ 35 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer of firming fluid to cleansed skin once or twice daily. Leave on. Follow with a moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942950432927,"sku":"","price":79.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/62a-bamboo-firming-fluid-400x400.jpg?v=1604874282"},{"product_id":"eminence-organics-bearberry-eye-repair-cream","title":"Eminence Organics Bearberry Eye Repair Cream","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Ultra-hydrating eye cream with bioactive ingredients to hydrate and nourish the appearance of skin around the fragile eye contour area. Meadow eyebright, hop and bearberry help to reduce the visible signs of aging.\\n\\nMade with Biodynamic® ingredients from Demeter International Certified Biodynamic® farms. \\n\\nRetail Size: 0.5 oz \/ 15 ml\\n\\n- Winner of Best Eye Cream, Spa \u0026amp; Wellness Mexico, 2016\\n- Winner of Dayspa Magazine's Editors' Choice, 2009\\n\\nHow to Use:\\nGently apply a thin layer to the eye contour area until absorbed. \\n\\nKey Ingredients:\\nBearberry Extract: brightens and is rich in antioxidants\\nRed Clover Extract: antioxidant\\nParsley Seed Extract: improves the appearance of skin radiance\\nEyebright: firms and brightens the appearance of skin\\nHop extract: calms and tones the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nEye area moisture levels are balanced\\nComplexion appears left more youthful and radiant\\nThe appearance of wrinkle depth is minimized\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eUltra-hydrating eye cream with bioactive ingredients to hydrate and nourish the appearance of skin around the fragile eye contour area. Meadow eyebright, hop and bearberry help to reduce the visible signs of aging.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eMade with Biodynamic® ingredients from Demeter International Certified Biodynamic® farms. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 0.5 oz \/ 15 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eGently apply a thin layer to the eye contour area until absorbed. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942957772959,"sku":"","price":89.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/63a-bearberry-eye-repair-cream-400x400px.png?v=1604874339"},{"product_id":"eminence-organics-birch-water-purifying-essence-4o","title":"Eminence Organics Birch Water Purifying Essence","description":"\u003cp\u003e\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Replenish skin with a lightweight essence that restores moisture levels. Birch water purifies the skin while botanical collagen increases elasticity and improves barrier function. An essential step that helps the skin better absorb and retain the benefits of subsequent products.\\n\\nRetail Size: 4 oz \/ 118 ml\\n\\nHow to use:\\nDispense a small amount of product in hands or on a cotton pad and pat onto cleansed and toned skin. Leave on.\\n\\nKey Ingredients:\\nBirch Water: nutrient-rich; purifies and hydrates skin, leaving it toned and tightened; helps minimize the visible effects of pollution \\nSnow Mushroom: ultra-hydrating antioxidant which enhances elasticity; improves skin barrier function \\nReishi Mushroom: contains a high concentration of polysaccharides which improve hydration; powerful source of antioxidants which help reduce puffiness  \\nBotanical Collagen: ultimate moisturizer to help skin retain hydration; reduces the look of wrinkles; skin appears tighter, firmer and plumper\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nResults:\\nReplenishes moisture \\nVisibly minimizes redness due to dryness \\nRestores elasticity\\nRejuvenates for more radiant skin \"}' data-sheets-userformat='{\"2\":4540,\"5\":{\"1\":[{\"1\":2,\"2\":0,\"5\":{\"1\":2,\"2\":0}},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"6\":{\"1\":[{\"1\":2,\"2\":0,\"5\":{\"1\":2,\"2\":0}},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"7\":{\"1\":[{\"1\":2,\"2\":0,\"5\":{\"1\":2,\"2\":0}},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"8\":{\"1\":[{\"1\":2,\"2\":0,\"5\":{\"1\":2,\"2\":0}},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eReplenish skin with a lightweight essence that restores moisture levels. Birch water purifies the skin while botanical collagen increases elasticity and improves barrier function. An essential step that helps the skin better absorb and retain the benefits of subsequent products.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 4 oz \/ 118 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003eDispense a small amount of product in hands or on a cotton pad and pat onto cleansed and toned skin. Leave on.\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942994636959,"sku":"","price":67.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/files\/IMG-2722.png?v=1756879024"},{"product_id":"eminence-organics-blueberry-soy-night-recovery-cream","title":"Eminence Organics Blueberry Soy Night Recovery Cream","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Stimulate your skin while you sleep. This cream repairs the appearance of aging skin and returns firmness during a very important time – the most active renewal happens while we rest. By harnessing the active nutrients of blueberry and soy milk, you can wake up looking great. \\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n- Winner of Best Face Product, LNE's Best, Les Nouvelles Esthétiques \u0026amp; Spa, 2008\\n- Winner of Professional Anti-Aging Product Award, B\u0026amp;H Beauty Pro Awards, Hong Kong, 2007\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nBlueberry: deep cleans pores, tightens and tones skin\\nNon-GMO Soy: reduces the appearance of wrinkles; rich in isoflavones and vitamins\\nShea Butter: moisturizes to repair the look of skin\\nRaspberry Juice: high in vitamins\\nGrape Seed Oil: delivers hydration\\nCalendula Oil: tones, tightens and supports the skin’s appearance through moisturization\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe visible signs of aging are reduced\\nRevitalizes the texture of the skin’s appearance\\nStimulates repair of the skin\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eStimulate your skin while you sleep. This cream repairs the appearance of aging skin and returns firmness during a very important time – the most active renewal happens while we rest. By harnessing the active nutrients of blueberry and soy milk, you can wake up looking great. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 2 oz \/ 60 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36942996471967,"sku":"","price":72.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/65a-blueberry-soy-night-recovery-cream-400x400px.png?v=1604874839"},{"product_id":"eminence-organics-bright-skin-cleanser","title":"Eminence Organics Bright Skin Cleanser","description":"\u003cp\u003e\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Brighten the appearance of skin and reduce the signs of aging with the help of our Bright Skin Cleanser. For normal to dry skin types, this cleanser uses two actives – Gigawhite and a Natural Hydroquinone Alternative – to give skin the appearance of being brighter and younger looking. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\\n\\nRetail Size: 8.4 oz \/ 250 ml\\n\\nHow to Use:\\nMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage in to skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\\n\\nKey Ingredients:\\nBearberry Extract: antioxidant; lightens the appearance of dark spots\\nGigaWhite™: antioxidant; a powerful blend to restore the appearance of luminosity to the skin\\nLicorice Root: antioxidant; soothing\\nNatural Hydroquinone Alternative: a natural brightening agent made with African potato and tara tree for the appearance of a smooth, radiant complexion\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin is perfectly cleansed and balanced\\nComplexion is clear, and appears smooth and even\\nSkin appears luminous and bright\\n\\nResults are enhanced when using entire Bright Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results.\\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eBrighten the appearance of skin and reduce the signs of aging with the help of our Bright Skin Cleanser. For normal to dry skin types, this cleanser uses two actives – Gigawhite and a Natural Hydroquinone Alternative – to give skin the appearance of being brighter and younger looking. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 8.4 oz \/ 250 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage in to skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36943012692127,"sku":"","price":57.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/67a-bright_skin_cleanser400pix.jpg?v=1604875193"},{"product_id":"eminence-organics-bright-skin-licorice-root-booster-serum","title":"Eminence Organics Bright Skin Licorice Root Booster-Serum","description":"\u003cp\u003e\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Reveal the look of your skin’s luminous complexion with this extra strength brightening serum and product enhancer, infused with Natural Hydroquinone Alternative and Gigawhite™. \\n\\nRetail Size: 1 oz  \/ 30 ml\\n\\nHow to Use:\\nApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\\n\\nKey Ingredients:\\nLicorice: brightens skin appearance\\nNatural Hydroquinone Alternative Complex: brightening with African potato and tara tree; antioxidant rich\\nLactic Acid: sloughs off dead skin cells to rejuvenate the appearance of skin\\nGigawhite™: brightens the look of skin\\nStone Crop: hydrating and nourishing for uneven skin tones\\nLemongrass: tones and cleanses skin\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin appears smoother, calmer and firmer\\nSkin is moisturized, more vitalized\\nComplexion appears lighter\\nSkin appearance is healthier\\n\\nResults are enhanced when using entire Bright Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eReveal the look of your skin’s luminous complexion with this extra strength brightening serum and product enhancer, infused with Natural Hydroquinone Alternative and Gigawhite™. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 1 oz  \/ 30 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36965933318303,"sku":"","price":69.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/files\/IMG-3924.jpg?v=1762173515"},{"product_id":"eminence-organics-bright-skin-overnight-correcting-cream","title":"Eminence Organics Bright Skin Overnight Correcting Cream","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Brighten skin with this ultra-rich moisturizer formulated to address the look of hyperpigmentation while you sleep. It delivers potent actives that visibly reduce the look of age and dark spots for a luminous complexion. In combination with a Natural Hydroquinone Alternative, these actives create our most powerful skin brightening botanical blend to date.\\n\\nRetail size: 2 oz \/ 60 ml\\n\\n- Winner of Best Hyperpigmentation Collection, ASCP Skin Deep Readers’ Choice Awards, 2018\\n- Winner of Brightening Category, Best Product Awards, LNE \u0026amp; Spa's, 2018\\n\\nHow to Use:\\nApply a layer over the entire face and neck area and leave on. For a lighter application, mix a small amount of product in your hand with a few drops of water. For extra hydration, apply a thicker layer in dry areas.\\n\\nUse with the complete Eminence Organics VitaSkin™ Bright Skin Collection range, including Eminence Organics Bright Skin Moisturizer SPF 30 during the day, to achieve even greater results.\\n\\nKey Ingredients:\\nNatural Hydroquinone Alternative: Brighten skin with African potato and tara tree. Aids in fading the look of age spots and freckles while promoting a smooth, even complexion.\\nGigawhite™: Skin brightener. Targets the appearance of melanin.\\nPunarnava Root Extract: Evens skin tone, and reduces the look of various types of dark spots\\nStone Crop: Brightens and moisturizes the skin.\\nLicorice Root Extract: Brightens the appearance of skin\\nBearberry Extract: Targets the look of hyperpigmentation\\nShea Butter: Moisturizing. High in triglycerides.\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nVisibly reduces the appearance of hyperpigmentation\\nRevitalizes and brightens skin\\nProtects against transepidermal water loss (TEWL)\\nImproves moisture and hydration\\n\\nResults are enhanced when using entire Bright Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eBrighten skin with this ultra-rich moisturizer formulated to address the look of hyperpigmentation while you sleep. It delivers potent actives that visibly reduce the look of age and dark spots for a luminous complexion. In combination with a Natural Hydroquinone Alternative, these actives create our most powerful skin brightening botanical blend to date.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail size: 2 oz \/ 60 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a layer over the entire face and neck area and leave on. For a lighter application, mix a small amount of product in your hand with a few drops of water. For extra hydration, apply a thicker layer in dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36965964906655,"sku":"","price":89.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/files\/IMG-3925.jpg?v=1762173622"},{"product_id":"eminence-organics-calm-skin-arnica-booster-serum","title":"Eminence Organics Calm Skin Arnica Booster-Serum","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Calm and balance your skin with this extra strength serum and product enhancer infused with arnica, chamomile and lavender. \\n\\nRetail Size: 1 oz \/ 30 ml\\n\\n- Winner of Best Organic Facial, Harper's Bazaar Malaysia Spa Awards, 2017\\n- Winner of Premium Organic Skincare Product, Sister's Beauty Pro Awards, Hong Kong, 2015 \\n\\nHow to Use:\\nApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\\n\\nKey Ingredients:\\nArnica: cleanser\\nIvy: tones and tightens the appearance of pores\\nRosehip: vitamin-C rich\\nHorse Chestnut: tones and tightens the appearance of skin\\nLavender: restores moisture to dry skin\\nChamomile: revitalizes, calms and balances the appearance of skin\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe appearance of redness is reduced\\nThe appearance of irritation and inflammation are calmed\\nComplexion appears toned and enriched\\nOxygenation and blood circulation is stimulated\\n\\nResults are enhanced when using entire Calm Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eCalm and balance your skin with this extra strength serum and product enhancer infused with arnica, chamomile and lavender. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cstrong\u003eRetail Size: 1 oz \/ 30 ml\u003c\/strong\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan style=\"text-decoration: underline;\"\u003e\u003cstrong\u003eHow to Use:\u003c\/strong\u003e\u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36965992792223,"sku":"","price":69.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/75a-calm-skin-arnica-booster-serum-400x400px_0.png?v=1605029506"},{"product_id":"eminence-organics-calm-skin-chamomile-cleanser","title":"Eminence Organics Calm Skin Chamomile Cleanser","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Gently remove impurities from your skin with our Calm Skin Chamomile Cleanser. Infused with chamomile, arnica and rosemary, this calming cream cleanser is perfect for sensitive skin that is prone to redness. It is cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\\n\\nRetail Size: 8.4 oz \/ 250 ml\\n\\n- Winner of Best Organic Facial, Harper's Bazaar Malaysia Spa Awards, 2017\\n\\nHow to Use:\\nMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage into skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\\n\\nKey Ingredients:\\nChamomile: revitalizes, calms and balances the appearance of skin\\nCalendula Oil: antioxidant, essential oil\\nSunflower Oil: protective; rich in vitamins A, D and E\\nArnica Extract: cleanser\\nGrape Leaf Extract: antioxidant; rich in polyphenols\\nRosemary: antioxidant, rejuvenating and soothing\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin is perfectly cleansed and balanced\\nReduced appearance of redness\\nReduced  irritation and inflammation\\n\\nResults are enhanced when using entire Calm Skin VitaSkin™ Solution\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eGently remove impurities from your skin with our Calm Skin Chamomile Cleanser. Infused with chamomile, arnica and rosemary, this calming cream cleanser is perfect for sensitive skin that is prone to redness. It is cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 8.4 oz \/ 250 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Organic Facial, Harper's Bazaar Malaysia Spa Awards, 2017\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage into skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eChamomile: revitalizes, calms and balances the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003eCalendula Oil: antioxidant, essential oil\u003cbr data-mce-fragment=\"1\"\u003eSunflower Oil: protective; rich in vitamins A, D and E\u003cbr data-mce-fragment=\"1\"\u003eArnica Extract: cleanser\u003cbr data-mce-fragment=\"1\"\u003eGrape Leaf Extract: antioxidant; rich in polyphenols\u003cbr data-mce-fragment=\"1\"\u003eRosemary: antioxidant, rejuvenating and soothing\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eSkin is perfectly cleansed and balanced\u003cbr data-mce-fragment=\"1\"\u003eReduced appearance of redness\u003cbr data-mce-fragment=\"1\"\u003eReduced  irritation and inflammation\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Calm Skin VitaSkin™ Solution\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966011502751,"sku":"","price":57.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/77a-calm_skin_chamomile_cleanser400pix.jpg?v=1605029643"},{"product_id":"eminence-organics-calm-skin-chamomile-moisturizer","title":"Eminence Organics Calm Skin Chamomile Moisturizer","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Soothe irritation and hydrate sensitive skin with calming chamomile and arnica. Combine those elements with shea butter and calendula oil, and this moisturizer will help relieve the appearance of redness.\\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n- Winner of Best Organic Facial, Harper's Bazaar Malaysia Spa Awards, 2017\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nChamomile: revitalizes, calms, and balances the appearance of skin\\nCalendula Oil: antioxidant, essential oil\\nShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\\nSunflower Oil: protective; rich in vitamins A, D and E\\nGrape Leaf Extract: antioxidant; rich in polyphenols\\nAloe Vera Juice: soothing and refreshing\\nRosemary:  antioxidant; rejuvenating and soothing\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe appearance of redness is reduced\\nSkin appears calmed\\nComplexion appears toned and enriched\\nSkin is left soft and hydrated\\n\\nResults are enhanced when using entire Calm Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eSoothe irritation and hydrate sensitive skin with calming chamomile and arnica. Combine those elements with shea butter and calendula oil, and this moisturizer will help relieve the appearance of redness.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Organic Facial, Harper's Bazaar Malaysia Spa Awards, 2017\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eChamomile: revitalizes, calms, and balances the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003eCalendula Oil: antioxidant, essential oil\u003cbr data-mce-fragment=\"1\"\u003eShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\u003cbr data-mce-fragment=\"1\"\u003eSunflower Oil: protective; rich in vitamins A, D and E\u003cbr data-mce-fragment=\"1\"\u003eGrape Leaf Extract: antioxidant; rich in polyphenols\u003cbr data-mce-fragment=\"1\"\u003eAloe Vera Juice: soothing and refreshing\u003cbr data-mce-fragment=\"1\"\u003eRosemary:  antioxidant; rejuvenating and soothing\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of redness is reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin appears calmed\u003cbr data-mce-fragment=\"1\"\u003eComplexion appears toned and enriched\u003cbr data-mce-fragment=\"1\"\u003eSkin is left soft and hydrated\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Calm Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966026477727,"sku":"","price":69.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/79a-calmskin-chamomile-moisturizer-400x400.jpg?v=1605029735"},{"product_id":"eminence-camellia-glow-solid-face-oil","title":"Eminence Organics Camellia Glow Solid Face Oil","description":"\u003cp\u003eThis beautiful solid face oil is blended with luxurious camellia oil, pink tourmaline gemstones and marula oil to soften and deeply hydrate the skin. Melt a small dab into your palm, close your eyes and let your senses guide you as you massage in to reveal your healthiest glow.\u003c\/p\u003e\n\u003cp\u003eRetail Size: 30 ml \/ 1 fl oz\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003eWinner of Best Face Oil - Skin Hydrators, 2021 New Beauty Awards\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cem\u003eWinner of Best Crystal-Infused Balm - Crystal Beauty, The Beauty Shortlist Awards 2021\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003eHow To Use:\u003cbr\u003eMelt a pea-sized amount of product in palms and apply to the face and neck with circular motions. Leave on. May be followed with a moisturizer.\u003cem\u003e\u003cbr\u003e\u003c\/em\u003e\u003c\/p\u003e\n\u003cp\u003eKey Ingredients:\u003cbr\u003eCamellia Oil: highly moisturizing; revitalizes and rejuvenates the look of skin, leaving the complexion looking soft and supple \u003cbr\u003ePink Tourmaline Gemstones: encourages the mind and spirit to feel positive thoughts, boosting a glow from within.\u003cbr\u003eMarula Oil: rich in fatty acids; super hydrator for soft, smooth skin; combats the visible signs of aging due to drying environmental stressors \u003cbr\u003eHemp Seed Oil: rich in vitamins and antioxidants that improve the appearance of aging; moisturizes the skin\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free \u003cbr\u003e\u003c\/span\u003e\u003cspan\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eResults:\u003cbr\u003e\u003c\/span\u003eSkin looks nourished and oxygenated \u003cbr\u003eSkin is left with a healthy glow \u003cbr\u003eComplexion appears soft and bright\u003c\/p\u003e\n\u003cp\u003eEminence Organics is constantly innovating our product formulations to deliver the best results.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003e\u003cbr\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966063472799,"sku":"","price":93.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/81a-camellia-glow-solid-face-oil-400x400.jpg?v=1605029854"},{"product_id":"cleanser-eminence-charcoal-exfoliating-gel-cleanse","title":"Eminence Organics Charcoal Exfoliating Gel Cleanser","description":"\u003cp\u003eFormulated with charcoal, malachite gemstones and blue matcha, this supercharged purifying cleanser transforms from a gel to an exfoliating lather to wash away impurities and reveal a balanced complexion.\u003c\/p\u003e\n\u003cp\u003eRetail Size: 150 ml \/ 5 fl oz\u003c\/p\u003e\n\u003cp\u003eHow To Use:\u003cbr\u003e\u003cspan data-mce-fragment=\"1\"\u003eMix a small amount of product with water in hands, apply and massage gently with fingertips in a circular motion covering the face and neck areas. Rinse thoroughly and pat dry. Do not use on broken or abraded skin.\u003c\/span\u003e\u003cbr\u003e\u003c\/p\u003e\n\u003cp\u003eKey Ingredients:\u003cbr\u003eCharcoal: draws out oil, dirt and other harmful substances from clogged pores due to its absorption powers; improves the appearance of skin health \u003cbr\u003eMalachite Gemstones: stone of transformation, helps the mind release stress and feel optimistic and balanced\u003cbr\u003eBlue Matcha (Butterfly Pea Flower): Rich in antioxidants that improve the visible signs of aging; increases the appearance of skin’s vitality \u003cbr\u003ePeppermint: rich in antioxidants and Vitamins A and C that target and improve the appearance of aging\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free \u003cbr\u003e\u003c\/span\u003e\u003cspan\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003c\/span\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003cspan\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003eResults:\u003cbr\u003e\u003c\/span\u003eSkin is left invigorated and looking energized \u003cbr\u003ePores are refined and minimized \u003cbr\u003eExcess oil is removed from the surface of the skin \u003c\/p\u003e\n\u003cp\u003eEminence Organics is constantly innovating our product formulations to deliver the best results.\u003c\/p\u003e\n\u003cp\u003e\u003cspan\u003e\u003cbr\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966084083871,"sku":"","price":68.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/83a-charcoal-exfoliating-cleanser-400x400.jpg?v=1605029939"},{"product_id":"eminence-organics-citrus-kale-potent-c-e-masque","title":"Eminence Organics Citrus \u0026 Kale Potent C+E Masque","description":"\u003cp\u003e\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Potent, cream-gel mask for all skin types. Harness the natural power of Vitamins C+E with a boost of nourishing vitamins for the skin. A cocktail of citrus, rhubarb extract, leafy greens and avocado oil forms helps reduce the appearance of sun damage and fine lines and wrinkles.\\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n - Winner of Editor's Choice, Family Circle Magazine, 2018\\n\\nHow to Use:\\nApply a thin layer of mask with fingertips to cleansed skin, avoiding the eye area. (Dilute with water for easier application). May use galvanic or ultrasound. Leave on for 5 minutes or longer (it is recommended to place wet gauze or cotton strips on top). Remove with a damp face cloth.\\n\\nKey Ingredients:\\nStabilized Vitamin C (L-Ascorbic Acid): sourced from lemon and grapefruit, this potent antioxidant reduces the appearance of redness and soothes inflammation.\\nSodium Ascorbyl Phosphate: also known as Vitamin C salt, this unique form of Vitamin C remains a salt until it penetrates the surface of the skin. It is only at this point that it turns into Vitamin C, allowing the full benefits to be absorbed by the skin for maximum results.\\nVitamin E: sourced from avocado; delivers nutrients to the skin to improve skin health.\\nBotanical Ferulic Acid: powerful antioxidant naturally derived from the leaves of plants. stabilizes the antioxidant benefits of Vitamin C and helps it retain potency.\\nLeafy Greens (Kale, Spinach \u0026amp; Broccoli Sprouts): high antioxidant content to help improve the appearance of skin elasticity and hydration for younger-looking skin.\\nCitrus Fruit Oils (Lemon \u0026amp; Grapefruit): tones and refreshes the skin. Additional naturally occurring Vitamin C content helps protect against the signs of aging. Astringent properties help to balance oil production.\\nAvocado \u0026amp; Acocado Oil: antioxidant that is moisturizing and hydrating to relieve dry and irritated skin.\\nPotato Juice: gently soothes skin and can help with uneven skin tones\\nRhubarb: a good source of antioxidant protection, improved the appearance of skin tone\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe appearance of visible signs of aging are reduced and further signs are prevented\\nCollagen formation is boosted and skin appears firmed and plumped\\nThe appearance of inflammation and redness are reduced\\nSkin appears hydrated, smooth and nourished\\n\\nEminence is constantly innovating our product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003ePotent, cream-gel mask for all skin types. Harness the natural power of Vitamins C+E with a boost of nourishing vitamins for the skin. A cocktail of citrus, rhubarb extract, leafy greens and avocado oil forms helps reduce the appearance of sun damage and fine lines and wrinkles.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Editor's Choice, Family Circle Magazine, 2018\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer of mask with fingertips to cleansed skin, avoiding the eye area. (Dilute with water for easier application). May use galvanic or ultrasound. Leave on for 5 minutes or longer (it is recommended to place wet gauze or cotton strips on top). Remove with a damp face cloth.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eStabilized Vitamin C (L-Ascorbic Acid): sourced from lemon and grapefruit, this potent antioxidant reduces the appearance of redness and soothes inflammation.\u003cbr data-mce-fragment=\"1\"\u003eSodium Ascorbyl Phosphate: also known as Vitamin C salt, this unique form of Vitamin C remains a salt until it penetrates the surface of the skin. It is only at this point that it turns into Vitamin C, allowing the full benefits to be absorbed by the skin for maximum results.\u003cbr data-mce-fragment=\"1\"\u003eVitamin E: sourced from avocado; delivers nutrients to the skin to improve skin health.\u003cbr data-mce-fragment=\"1\"\u003eBotanical Ferulic Acid: powerful antioxidant naturally derived from the leaves of plants. stabilizes the antioxidant benefits of Vitamin C and helps it retain potency.\u003cbr data-mce-fragment=\"1\"\u003eLeafy Greens (Kale, Spinach \u0026amp; Broccoli Sprouts): high antioxidant content to help improve the appearance of skin elasticity and hydration for younger-looking skin.\u003cbr data-mce-fragment=\"1\"\u003eCitrus Fruit Oils (Lemon \u0026amp; Grapefruit): tones and refreshes the skin. Additional naturally occurring Vitamin C content helps protect against the signs of aging. Astringent properties help to balance oil production.\u003cbr data-mce-fragment=\"1\"\u003eAvocado \u0026amp; Avocado Oil: antioxidant that is moisturizing and hydrating to relieve dry and irritated skin.\u003cbr data-mce-fragment=\"1\"\u003ePotato Juice: gently soothes skin and can help with uneven skin tones\u003cbr data-mce-fragment=\"1\"\u003eRhubarb: a good source of antioxidant protection, improved the appearance of skin tone\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of visible signs of aging are reduced and further signs are prevented\u003cbr data-mce-fragment=\"1\"\u003eCollagen formation is boosted and skin appears firmed and plumped\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of inflammation and redness are reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin appears hydrated, smooth and nourished\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence is constantly innovating our product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e\u003c\/p\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966132973727,"sku":"","price":79.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/87a-citrus-kale-potent-ce-masque-400x400px.png?v=1605030239"},{"product_id":"eminence-organics-citrus-kale-potent-c-e-serum","title":"Eminence Organics Citrus \u0026 Kale Potent C+E Serum","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Fast-absorbing, advanced serum for all skin types. This potent dose of non-irritating Vitamin C is stabilized by botanically-derived ferulic acid to deliver optimal antioxidant benefits and improve the appearance of skin.\\n\\nRetail Size: 1 oz \/ 30 ml\\n\\n- Winner of Best Vitamin C Serum, Aestheticians’ Choice Awards 2016, Dermascope 2016\\n- Winner of the Serum Category, Natural Beauty Awards, Nature \u0026amp; Health, 2016\\n\\nHow to Use:\\nApply a thin layer of serum to cleansed skin. Excellent for use after stimulating treatments, between treatments or as a finishing product. Leave on. Follow with a moisturizer.\\n\\nKey Ingredients:\\nStabilized Vitamin C (L-Ascorbic Acid): sourced from lemon and grapefruit, this potent antioxidant reduces the appearance of redness and soothes inflammation.\\nSodium Ascorbyl Phosphate: Also known as Vitamin C salt, this unique form of Vitamin C remains a salt until it penetrates the surface of the skin. It is only at this point that it turns into Vitamin C, allowing the full benefits to be experienced.\\nVitamin E: Sourced from avocado; delivers nutrients to the skin to improve the appearance of skin health.\\nBotanical Ferulic Acid: Powerful antioxidant naturally derived from the leaves of plants. Stabilizes the antioxidant benefits of Vitamin C and helps it retain potency.\\nLeafy Greens (Kale, Spinach \u0026amp; Broccoli Sprouts): High antioxidant content to help improve the appearance of skin elasticity and hydration for younger-looking skin.\\nCitrus Fruit Oils (Lemon \u0026amp; Grapefruit): Tones and refreshes the skin. Additional naturally occurring Vitamin C content helps protect against the visible signs of aging. Astringent properties help to balance oil production.\\nAvocado: Antioxidant that is moisturizing and hydrating to relieve dry and irritated skin.\\nHydrolyzed Botanical Hyaluronic Acid (from grass extract): Deeply hydrating; natural substance that keeps skin looking plump to minimize the appearance of fine lines and wrinkles.\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nCollagen formation is boosted and skin appears firmed and plumped\\nThe appearance of inflammation and redness are reduced\\nThe appearance of visible signs of aging are reduced and further signs are prevented\\n\\nEminence Organics is constantly innovating our product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eFast-absorbing, advanced serum for all skin types. This potent dose of non-irritating Vitamin C is stabilized by botanically-derived ferulic acid to deliver optimal antioxidant benefits and improve the appearance of skin.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Vitamin C Serum, Aestheticians’ Choice Awards 2016, Dermascope 2016\u003cbr data-mce-fragment=\"1\"\u003e- Winner of the Serum Category, Natural Beauty Awards, Nature \u0026amp; Health, 2016\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer of serum to cleansed skin. Excellent for use after stimulating treatments, between treatments or as a finishing product. Leave on. Follow with a moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eStabilized Vitamin C (L-Ascorbic Acid): sourced from lemon and grapefruit, this potent antioxidant reduces the appearance of redness and soothes inflammation.\u003cbr data-mce-fragment=\"1\"\u003eSodium Ascorbyl Phosphate: Also known as Vitamin C salt, this unique form of Vitamin C remains a salt until it penetrates the surface of the skin. It is only at this point that it turns into Vitamin C, allowing the full benefits to be experienced.\u003cbr data-mce-fragment=\"1\"\u003eVitamin E: Sourced from avocado; delivers nutrients to the skin to improve the appearance of skin health.\u003cbr data-mce-fragment=\"1\"\u003eBotanical Ferulic Acid: Powerful antioxidant naturally derived from the leaves of plants. Stabilizes the antioxidant benefits of Vitamin C and helps it retain potency.\u003cbr data-mce-fragment=\"1\"\u003eLeafy Greens (Kale, Spinach \u0026amp; Broccoli Sprouts): High antioxidant content to help improve the appearance of skin elasticity and hydration for younger-looking skin.\u003cbr data-mce-fragment=\"1\"\u003eCitrus Fruit Oils (Lemon \u0026amp; Grapefruit): Tones and refreshes the skin. Additional naturally occurring Vitamin C content helps protect against the visible signs of aging. Astringent properties help to balance oil production.\u003cbr data-mce-fragment=\"1\"\u003eAvocado: Antioxidant that is moisturizing and hydrating to relieve dry and irritated skin.\u003cbr data-mce-fragment=\"1\"\u003eHydrolyzed Botanical Hyaluronic Acid (from grass extract): Deeply hydrating; natural substance that keeps skin looking plump to minimize the appearance of fine lines and wrinkles.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eCollagen formation is boosted and skin appears firmed and plumped\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of inflammation and redness are reduced\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of visible signs of aging are reduced and further signs are prevented\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating our product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966140313759,"sku":"","price":125.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/88a-citrus-kale-potent-ce-serum-400x400px_0.png?v=1605030278"},{"product_id":"eminence-organics-clear-skin-probiotic-cleanser","title":"Eminence Organics Clear Skin Probiotic Cleanser","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Cool and balance your skin with our Clear Skin Probiotic Cleanser. This clarifying cream-gel cleanser treats oily and problem skin with cucumber and tea tree oil. Sweet almond milk and yogurt reduce the visible signs of problem skin and breakouts without stripping the skin of moisture. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, phthalates, GMOs and triclosan.\\n\\nRetail Size: 8.4 oz \/ 250 ml\\n\\n- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \\n- Winner of Best Acne Cleanser, 1st Place - Aesthetician's Choice Awards, Dermascope, 2017\\n- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017\\n- Winner of Top 10 Best Facewash, Spirituality \u0026amp; Health The Beauty 100, 2016\\n\\nHow to Use:\\nMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage into skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\\n\\nKey Ingredients:\\nCucumber Juice: revitalizer, toner; tones and shrinks the appearance of skin pores while purifying the skin\\nYogurt: exfoliating; contains lactic acid; moisturizing and nourishing\\nSweet Almond Milk: softening, nourishing and sweet-smelling\\nTea Tree Oil: an essential oil\\nWillow Bark Extract: astringent\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe skin is perfectly cleansed and calmed\\nAppearance of Blemished areas are improved\\nPore size appears minimized\\nSkin is purified and detoxified\\n\\nResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eCool and balance your skin with our Clear Skin Probiotic Cleanser. This clarifying cream-gel cleanser treats oily and problem skin with cucumber and tea tree oil. Sweet almond milk and yogurt reduce the visible signs of problem skin and breakouts without stripping the skin of moisture. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 8.4 oz \/ 250 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Cleanser, 1st Place - Aesthetician's Choice Awards, Dermascope, 2017\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Top 10 Best Facewash, Spirituality \u0026amp; Health The Beauty 100, 2016\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage into skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eCucumber Juice: revitalizer, toner; tones and shrinks the appearance of skin pores while purifying the skin\u003cbr data-mce-fragment=\"1\"\u003eYogurt: exfoliating; contains lactic acid; moisturizing and nourishing\u003cbr data-mce-fragment=\"1\"\u003eSweet Almond Milk: softening, nourishing and sweet-smelling\u003cbr data-mce-fragment=\"1\"\u003eTea Tree Oil: an essential oil\u003cbr data-mce-fragment=\"1\"\u003eWillow Bark Extract: astringent\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe skin is perfectly cleansed and calmed\u003cbr data-mce-fragment=\"1\"\u003eAppearance of Blemished areas are improved\u003cbr data-mce-fragment=\"1\"\u003ePore size appears minimized\u003cbr data-mce-fragment=\"1\"\u003eSkin is purified and detoxified\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966156435615,"sku":"","price":57.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/91a-clear_skin_probiotic_cleanser400pix.jpg?v=1605030395"},{"product_id":"eminence-organics-clear-skin-probiotic-masque","title":"Eminence Organics Clear Skin Probiotic Masque","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;The clear solution to problem skin. Attain the appearance of a radiant and clear complexion thanks to cooling cucumber tones and refining yogurt, which exfoliates and eliminates the appearance of blemishes. \\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \\n- Winner of Bronze Medal for Problem Skin, Free From Awards, UK, 2018\\n- Winner of Best Acne Mask, 1st Place - Aesthetician's Choice Awards, Dermascope, 2017\\n- Winner of Best Skincare Product for Acne, Beauty Shortlist Awards , UK, 2017\\n- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017 \\n- Winner of Best Face Mask, DaySpa Professional Choice Awards, 2017\\n- Winner of Best Organic Skin Care Product, Sister's Beauty Pro Awards, Hong Kong, 2011\\n\\nHow to Use:\\nEmulsify a small amount of mak in your hand with a few drops of water. Apply evenly over the entire face as well as the neck and décolleté areas if desired. Allow mask to dry 5–10 minutes then gently scrub off in a circular motion with a lukewarm face cloth. Rinse thoroughly with clear water.\\n\\nKey Ingredients:\\nYogurt: source of lactic acid, moisturizes and feels cooling on the skin\\nCucumber: tones the skin’s appearance\\nShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\\nMarigold: beta-carotene rich; gently cools, softens, and moisturizes skin’s appearance\\nKaolin Clay: cleans and softens skin’s appearance\\nStone Crop: hydrating and nourishing for uneven skin tones\\nTea Tree Oil: an essential oil \\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nProblem areas appear improved\\nSkin is left soft and appears noticeably smoother\\nThe appearance of pore size is minimized\\n\\nResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eThe clear solution to problem skin. Attain the appearance of a radiant and clear complexion thanks to cooling cucumber tones and refining yogurt, which exfoliates and eliminates the appearance of blemishes. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \u003cbr data-mce-fragment=\"1\"\u003e- Winner of Bronze Medal for Problem Skin, Free From Awards, UK, 2018\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Mask, 1st Place - Aesthetician's Choice Awards, Dermascope, 2017\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Skincare Product for Acne, Beauty Shortlist Awards , UK, 2017\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017 \u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Face Mask, DaySpa Professional Choice Awards, 2017\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Organic Skin Care Product, Sister's Beauty Pro Awards, Hong Kong, 2011\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eEmulsify a small amount of mak in your hand with a few drops of water. Apply evenly over the entire face as well as the neck and décolleté areas if desired. Allow mask to dry 5–10 minutes then gently scrub off in a circular motion with a lukewarm face cloth. Rinse thoroughly with clear water.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eYogurt: source of lactic acid, moisturizes and feels cooling on the skin\u003cbr data-mce-fragment=\"1\"\u003eCucumber: tones the skin’s appearance\u003cbr data-mce-fragment=\"1\"\u003eShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\u003cbr data-mce-fragment=\"1\"\u003eMarigold: beta-carotene rich; gently cools, softens, and moisturizes skin’s appearance\u003cbr data-mce-fragment=\"1\"\u003eKaolin Clay: cleans and softens skin’s appearance\u003cbr data-mce-fragment=\"1\"\u003eStone Crop: hydrating and nourishing for uneven skin tones\u003cbr data-mce-fragment=\"1\"\u003eTea Tree Oil: an essential oil \u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eProblem areas appear improved\u003cbr data-mce-fragment=\"1\"\u003eSkin is left soft and appears noticeably smoother\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of pore size is minimized\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966159941791,"sku":"","price":69.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/92a-clear_skin_probiotic_masque.jpg?v=1605030426"},{"product_id":"eminence-organics-clear-skin-probiotic-moisturizer","title":"Eminence Organics Clear Skin Probiotic Moisturizer","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Use this ultra-light daily moisturizer to detoxify and clear the appearance of problem skin, while leaving behind the appearance of irritation or clogged pores. Cucumber and tea tree help prevent the appearance of blemishes and reduce the appearance of inflammation while probiotics exfoliate and soothe the complexion. \\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \\n- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nCucumber Juice: revitalizer, toner; tones and shrinks the appearance of skin pores while purifying the skin\\nWillow Bark Extract: astringent\\nYogurt: exfoliating; contains lactic acid; moisturizing and nourishing\\nTea Tree Oil: an essential oil\\nCalendula Oil: antioxidant, essential oil\\nShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nProblem skin areas appear improved\\nPore size appear minimized\\nSkin appears soft and noticeably smoother\\nMoisture balance in the skin is improved\\n\\nResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eUse this ultra-light daily moisturizer to detoxify and clear the appearance of problem skin, while leaving behind the appearance of irritation or clogged pores. Cucumber and tea tree help prevent the appearance of blemishes and reduce the appearance of inflammation while probiotics exfoliate and soothe the complexion. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eCucumber Juice: revitalizer, toner; tones and shrinks the appearance of skin pores while purifying the skin\u003cbr data-mce-fragment=\"1\"\u003eWillow Bark Extract: astringent\u003cbr data-mce-fragment=\"1\"\u003eYogurt: exfoliating; contains lactic acid; moisturizing and nourishing\u003cbr data-mce-fragment=\"1\"\u003eTea Tree Oil: an essential oil\u003cbr data-mce-fragment=\"1\"\u003eCalendula Oil: antioxidant, essential oil\u003cbr data-mce-fragment=\"1\"\u003eShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eProblem skin areas appear improved\u003cbr data-mce-fragment=\"1\"\u003ePore size appear minimized\u003cbr data-mce-fragment=\"1\"\u003eSkin appears soft and noticeably smoother\u003cbr data-mce-fragment=\"1\"\u003eMoisture balance in the skin is improved\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36966172754079,"sku":"","price":74.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/93a-clear_skin_probiotic_moisturizer_0.jpg?v=1605030500"},{"product_id":"eminence-organics-clear-skin-starter-set","title":"Eminence Organics Clear Skin Starter Set","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Our Clear Skin Starter Set is beautifully packaged with a one-month’s supply of targeted organic products to treat oily and problem skin types. \\n\\nStarter Set Includes:\\nClear Skin Probiotic Cleanser (1 oz \/ 30 ml tube)\\nClear Skin Probiotic Moisturizer (0.5 oz \/ 15 ml tube)\\nClear Skin Probiotic Masque (0.5 oz \/ 15 ml jar)\\nClear Skin Willow Bark Booster-Serum (0.5 oz \/ 15 ml bottle) \\nOne classic cosmetic bag in woven faux leather with bamboo zipper\\n\\n- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \\n- Winner of Best Skincare Product for Acne, Beauty Shortlist Awards, UK, 2017 - Clear Skin Starter Set\\n- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017 - Clear Skin Starter Set ​\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eOur Clear Skin Starter Set is beautifully packaged with a one-month’s supply of targeted organic products to treat oily and problem skin types. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eStarter Set Includes:\u003cbr data-mce-fragment=\"1\"\u003eClear Skin Probiotic Cleanser (1 oz \/ 30 ml tube)\u003cbr data-mce-fragment=\"1\"\u003eClear Skin Probiotic Moisturizer (0.5 oz \/ 15 ml tube)\u003cbr data-mce-fragment=\"1\"\u003eClear Skin Probiotic Masque (0.5 oz \/ 15 ml jar)\u003cbr data-mce-fragment=\"1\"\u003eClear Skin Willow Bark Booster-Serum (0.5 oz \/ 15 ml bottle) \u003cbr data-mce-fragment=\"1\"\u003eOne classic cosmetic bag in woven faux leather with bamboo zipper\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Skincare Product for Acne, Beauty Shortlist Awards, UK, 2017 - Clear Skin Starter Set\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017 - Clear Skin Starter Set ​\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36967920959647,"sku":"","price":58.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/94a-clearskinstarterset_keyimage.jpg?v=1605040213"},{"product_id":"eminence-organics-clear-skin-willow-bark-booster-serum","title":"Eminence Organics Clear Skin Willow Bark Booster-Serum","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Help heal irritation and reduce the appearance of problem skin with this concentrated serum and product enhancer infused with willow bark and tea tree oil.\\n\\nRetail Size: 1 oz \/ 30 ml\\n\\n- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018  \\n- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017\\n- Winner of Best Acne Treatment, Beauty Awards, The Knot, 2015\\n- Winner of Premium Organic Skin Care Product, Sister's Beauty Pro Awards, Hong Kong, 2013\\n\\nHow to Use:\\nApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\\n\\nKey Ingredients:\\nWillow Bark: calms skin\\nHorsetail: softens  and tones the skin’s appearance and promotes the look of elasticity\\nWalnut Leaf: provides gentle exfoliation\\nAnise: antioxidant rich\\nTea Tree Oil: essential oil \\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nProblem areas are improved\\nThe appearance of pore size is minimized\\nSkin appears soft and noticeably smoother\\nSkin appears purified and detoxified\\n\\nResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eHelp heal irritation and reduce the appearance of problem skin with this concentrated serum and product enhancer infused with willow bark and tea tree oil.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 \u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Collection, DaySpa Professional Choice Awards, 2017\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Acne Treatment, Beauty Awards, The Knot, 2015\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Premium Organic Skin Care Product, Sister's Beauty Pro Awards, Hong Kong, 2013\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eWillow Bark: calms skin\u003cbr data-mce-fragment=\"1\"\u003eHorsetail: softens  and tones the skin’s appearance and promotes the look of elasticity\u003cbr data-mce-fragment=\"1\"\u003eWalnut Leaf: provides gentle exfoliation\u003cbr data-mce-fragment=\"1\"\u003eAnise: antioxidant rich\u003cbr data-mce-fragment=\"1\"\u003eTea Tree Oil: essential oil \u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eProblem areas are improved\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of pore size is minimized\u003cbr data-mce-fragment=\"1\"\u003eSkin appears soft and noticeably smoother\u003cbr data-mce-fragment=\"1\"\u003eSkin appears purified and detoxified\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Clear Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36967931609247,"sku":"","price":69.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/96a-clear-skin-willow-bark-booster-serum-400x400px.png?v=1605040290"},{"product_id":"eminence-organics-coconut-age-corrective-moisturizer","title":"Eminence Organics Coconut Age Corrective Moisturizer","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;With each application of our Coconut Age Corrective Moisturizer, you’ll feel your skin instantly tighten and lift. Coconut, shea butter and grape seed oil combine with green apple stem cell technology that offers lasting age correction. \\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\\n- Winner of Best Moisturizer, ASCP Skin Deep Readers’ Choice Awards, 2018 \\n- Winner of Youth-Boosting Moisturizer, NewBeauty’s Best Products In The World, New Beauty Magazine, 2018\\n- Winner of Best Face Moisturizer, Professional Choice Awards, DaySpa, 2018\\n- Winner of Best Natural Moisturizer, 1st Place - Aesthetician's Choice Awards, Dermascope, 2017\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nCoconut Oil: antioxidant; moisturizes the skin\\nCoconut Water: moisture and pH balancing; toning; source of electrolytes, Vitamin C, calcium, potassium, phosphorus\\nNatural Retinol Alternative Complex: skin appears immediately lifted and tightened; contains chicory root oligosaccharides and tara tree gum\\nPhytoCellTec™ Swiss Green Apple Stem Cells: plant stem cell concentrate; promotes elasticity and delays the visible signs of aging\\nShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults\\nEpidermis appears firmer and tighter\\nSkin is protected against free radicals\\nThe visible signs of aging are reduced\\nSkin appears firm\\nSkin appears smooth and toned\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eWith each application of our Coconut Age Corrective Moisturizer, you’ll feel your skin instantly tighten and lift. Coconut, shea butter and grape seed oil combine with green apple stem cell technology that offers lasting age correction. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Moisturizer, ASCP Skin Deep Readers’ Choice Awards, 2018 \u003cbr data-mce-fragment=\"1\"\u003e- Winner of Youth-Boosting Moisturizer, NewBeauty’s Best Products In The World, New Beauty Magazine, 2018\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Face Moisturizer, Professional Choice Awards, DaySpa, 2018\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Natural Moisturizer, 1st Place - Aesthetician's Choice Awards, Dermascope, 2017\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eCoconut Oil: antioxidant; moisturizes the skin\u003cbr data-mce-fragment=\"1\"\u003eCoconut Water: moisture and pH balancing; toning; source of electrolytes, Vitamin C, calcium, potassium, phosphorus\u003cbr data-mce-fragment=\"1\"\u003eNatural Retinol Alternative Complex: skin appears immediately lifted and tightened; contains chicory root oligosaccharides and tara tree gum\u003cbr data-mce-fragment=\"1\"\u003ePhytoCellTec™ Swiss Green Apple Stem Cells: plant stem cell concentrate; promotes elasticity and delays the visible signs of aging\u003cbr data-mce-fragment=\"1\"\u003eShea Butter: moisturizer high in triglycerides and fatty acids; excellent emollient for skin; replenishes the skin moisture barrier\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults\u003cbr data-mce-fragment=\"1\"\u003eEpidermis appears firmer and tighter\u003cbr data-mce-fragment=\"1\"\u003eSkin is protected against free radicals\u003cbr data-mce-fragment=\"1\"\u003eThe visible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin appears firm\u003cbr data-mce-fragment=\"1\"\u003eSkin appears smooth and toned\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36967942553759,"sku":"","price":79.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/98a-coconutagecorrectivemoisturize_keyimage.jpg?v=1605040356"},{"product_id":"eminence-organics-coconut-firming-body-lotion","title":"Eminence Organics Coconut Firming Body Lotion","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Coconut, shea butter and grape seed oil will leave your skin looking tight and firm, while providing deep and lasting hydration. \\n\\nRetail Size: 8.4 oz \/ 250 ml\\n\\n- Winner of Best Double-Duty Body Lotion, Beauty Choice Awards, NewBeauty 2016\\n\\nHow to Use:\\nApply a small amount to cleansed skin. Massage in. Leave on. Recommended after exfoliation, shower, or body scrub. For a lighter application, dilute with water. Do not use on broken or abraded skin.\\n\\nKey Ingredients:\\nCoconut Milk: moisturizing and nourishing; softens the look of skin\\nCoconut Water: moisturizing and toning; source of electrolytes, vitamin C, calcium, potassium, phosphorus \\nNatural Retinol Alternative Complex: contains chicory root oligosaccharides and tara tree; collagen boosting; firms and smoothes the appearance of skin\\nPhytoCellTec™ Swiss Green Apple Stem Cells: rejuvenating plant stem cell concentrate\\nBotanical Hyaluronic Acid (derived from Marshmallow Plant): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nEpidermis instantly feels firmer and tighter\\nSkin appears moisturized and revitalized\\nSkin texture appears smooth and velvety\\nThe appearance of elasticity is returned for smooth looking skin\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eCoconut, shea butter and grape seed oil will leave your skin looking tight and firm, while providing deep and lasting hydration. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 8.4 oz \/ 250 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Double-Duty Body Lotion, Beauty Choice Awards, NewBeauty 2016\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a small amount to cleansed skin. Massage in. Leave on. Recommended after exfoliation, shower, or body scrub. For a lighter application, dilute with water. Do not use on broken or abraded skin.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eCoconut Milk: moisturizing and nourishing; softens the look of skin\u003cbr data-mce-fragment=\"1\"\u003eCoconut Water: moisturizing and toning; source of electrolytes, vitamin C, calcium, potassium, phosphorus \u003cbr data-mce-fragment=\"1\"\u003eNatural Retinol Alternative Complex: contains chicory root oligosaccharides and tara tree; collagen boosting; firms and smoothes the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003ePhytoCellTec™ Swiss Green Apple Stem Cells: rejuvenating plant stem cell concentrate\u003cbr data-mce-fragment=\"1\"\u003eBotanical Hyaluronic Acid (derived from Marshmallow Plant): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eEpidermis instantly feels firmer and tighter\u003cbr data-mce-fragment=\"1\"\u003eSkin appears moisturized and revitalized\u003cbr data-mce-fragment=\"1\"\u003eSkin texture appears smooth and velvety\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of elasticity is returned for smooth looking skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36967954874527,"sku":"","price":43.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/100a-coconut_firming_body_lotion400pix.jpg?v=1605040420"},{"product_id":"eminence-organics-coconut-milk-cleanser","title":"Eminence Organics Coconut Milk Cleanser","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Created to comfort dry, irritated or sunburned skin, this gentle cream cleanser uses rich coconut milk to nurture skin for a dewy, fresh finish. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\\n\\nRetail Size: 8.4 oz \/ 250 ml\\n\\nHow to Use:\\nApply cleanser to the skin, emulsifying with fingertips and diluting with water, if necessary. Remove with a damp face cloth and follow with the appropriate toner for skin type.\\n\\nKey Ingredients:\\nCoconut Milk: moisturizes, nourishes and softens the skin\\nVirgin Coconut Oil: antioxidant: moisturizes to protect the skin\\nCalendula Oil: antioxidant; soothing\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe skin is perfectly cleansed and appears balanced\\nThe skin is left feeling hydrated\\nThe skin looks and feels more youthful\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eCreated to comfort dry, irritated or sunburned skin, this gentle cream cleanser uses rich coconut milk to nurture skin for a dewy, fresh finish. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 8.4 oz \/ 250 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply cleanser to the skin, emulsifying with fingertips and diluting with water, if necessary. Remove with a damp face cloth and follow with the appropriate toner for skin type.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eCoconut Milk: moisturizes, nourishes and softens the skin\u003cbr data-mce-fragment=\"1\"\u003eVirgin Coconut Oil: antioxidant: moisturizes to protect the skin\u003cbr data-mce-fragment=\"1\"\u003eCalendula Oil: antioxidant; soothing\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe skin is perfectly cleansed and appears balanced\u003cbr data-mce-fragment=\"1\"\u003eThe skin is left feeling hydrated\u003cbr data-mce-fragment=\"1\"\u003eThe skin looks and feels more youthful\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36967958806687,"sku":"","price":57.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/101a-coconut_milk_cleanser400pix.jpg?v=1605040456"},{"product_id":"eminence-organics-echinacea-recovery-cream","title":"Eminence Organics Echinacea Recovery Cream","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Echinacea, yarrow and evening primrose oil help repair the visible signs of aging without leaving behind a greasy feeling on your skin. This soothing fluid cream is perfect dehydrated or irritated skin. \\n\\nMade with Biodynamic® ingredients from Demeter International Certified Biodynamic® farms. \\n\\nRetail Size: 1 oz \/ 30 ml\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nEchinacea: protects skin against the abuse of the elements\\nYarrow Herb: rich in nutrients; promotes healing via moisturization\\nAloe Vera: promotes the look of elasticity\\nEvening Primrose Oil: hydrating, calming and restorative\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe visible signs of aging are reduced\\nComplexion appears moisturized and revitalized\\nHydrates without a greasy appearance\\nReduces the appearance of irritation\\nHelps to prevent the appearance of problem skin\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eEchinacea, yarrow and evening primrose oil help repair the visible signs of aging without leaving behind a greasy feeling on your skin. This soothing fluid cream is perfect dehydrated or irritated skin. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eMade with Biodynamic® ingredients from Demeter International Certified Biodynamic® farms. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eEchinacea: protects skin against the abuse of the elements\u003cbr data-mce-fragment=\"1\"\u003eYarrow Herb: rich in nutrients; promotes healing via moisturization\u003cbr data-mce-fragment=\"1\"\u003eAloe Vera: promotes the look of elasticity\u003cbr data-mce-fragment=\"1\"\u003eEvening Primrose Oil: hydrating, calming and restorative\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe visible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eComplexion appears moisturized and revitalized\u003cbr data-mce-fragment=\"1\"\u003eHydrates without a greasy appearance\u003cbr data-mce-fragment=\"1\"\u003eReduces the appearance of irritation\u003cbr data-mce-fragment=\"1\"\u003eHelps to prevent the appearance of problem skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36967986561183,"sku":"","price":78.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/107a-echinacea-recovery-cream-400x400px.png?v=1605040677"},{"product_id":"eminence-organics-eight-greens-phyto-masque-hot","title":"Eminence Organics Eight Greens Phyto Masque (Hot)","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"The whole plants and seeds in our Eight Greens Phyto Masque are naturally high in phytoestrogens and antioxidants. This unique mask will help improve hydration and the look of elasticity, improve the appearance of signs of aging, and normalize oily skin and prevent the appearance of breakouts. All to return your skin to its youthful looking glow. \\n\\nRetail Size: 2 oz \/ 60 ml\\n\\nHow to Use:\\nEmulsify a small amount of mask in your hand with a few drops of water. Apply evenly over the entire face as well as the neck and décolleté areas if desired. Allow mask to dry 5–10 minutes then gently scrub off in a circular motion with a lukewarm face cloth. Rinse thoroughly with water.\\n\\nDue to heightened circulation, a slight redness and hot sensation will occur and remain active for 5-10 minutes with a resulting rosy color.\\n\\nKey Ingredients:\\nYucca Extract: antioxidant\\nFlaxseed\/Linseed Extract: Omega 3s, antioxidant\\nHop Extract: antioxidant\\nPaprika: invigorates and rejuvenates the look of skin\\nChasteberry: source of antioxidant bioflavanoids\\nHoney: moisturizes and nourishes the skin’s appearance\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nImmediate skin stimulation resulting in a rosy glow\\nStimulation of blood circulation\\nThe appearance of firm, fresh and smooth skin\\nImproved appearance of problem skin areas\\nRevitalized, more youthful looking complexion\\nImproved reduction in appearance of fine lines and skin texture\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eThe whole plants and seeds in our Eight Greens Phyto Masque are naturally high in phytoestrogens and antioxidants. This unique mask will help improve hydration and the look of elasticity, improve the appearance of signs of aging, and normalize oily skin and prevent the appearance of breakouts. All to return your skin to its youthful looking glow. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eEmulsify a small amount of mask in your hand with a few drops of water. Apply evenly over the entire face as well as the neck and décolleté areas if desired. Allow mask to dry 5–10 minutes then gently scrub off in a circular motion with a lukewarm face cloth. Rinse thoroughly with water.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eDue to heightened circulation, a slight redness and hot sensation will occur and remain active for 5-10 minutes with a resulting rosy color.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eYucca Extract: antioxidant\u003cbr data-mce-fragment=\"1\"\u003eFlaxseed\/Linseed Extract: Omega 3s, antioxidant\u003cbr data-mce-fragment=\"1\"\u003eHop Extract: antioxidant\u003cbr data-mce-fragment=\"1\"\u003ePaprika: invigorates and rejuvenates the look of skin\u003cbr data-mce-fragment=\"1\"\u003eChasteberry: source of antioxidant bioflavanoids\u003cbr data-mce-fragment=\"1\"\u003eHoney: moisturizes and nourishes the skin’s appearance\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eImmediate skin stimulation resulting in a rosy glow\u003cbr data-mce-fragment=\"1\"\u003eStimulation of blood circulation\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of firm, fresh and smooth skin\u003cbr data-mce-fragment=\"1\"\u003eImproved appearance of problem skin areas\u003cbr data-mce-fragment=\"1\"\u003eRevitalized, more youthful looking complexion\u003cbr data-mce-fragment=\"1\"\u003eImproved reduction in appearance of fine lines and skin texture\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36967990526111,"sku":"","price":69.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/108a-eight_greens_phyto_masque_hot_allurecleanbeauty2020.jpg?v=1605040709"},{"product_id":"eminence-organics-eight-greens-youth-serum","title":"Eminence Organics Eight Greens Youth Serum","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Treat the visible signs of aging with this powerful combination of organic phytoestrogens. Concentrated whole plant yucca, chasteberry and flax seed extract are all active ingredients in helping with the appearance of tight and bright skin.\\n\\nRetail Size: 1 oz \/ 30 ml\\n\\nHow to Use:\\nApply a thin layer over the entire face, or apply to affected areas 1–3 times per day.\\n\\nKey Ingredients:\\nYucca Extract: antioxidant; source of phytoestrogens\\nFlaxseed\/Linseed Extract: Omega 3s, antioxidant\\nHop Extract: antioxidant\\nPaprika: invigorates and rejuvenates the look of skin\\nChasteberry: source of antioxidant bioflavanoids\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nEpidermis appears firmer and tighter\\nThe appearance of skin elasticity is improved\\nSkin appears less oily\\nSkin is more hydrated without appearing oily\\nSkin appears smoother and more silky\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eTreat the visible signs of aging with this powerful combination of organic phytoestrogens. Concentrated whole plant yucca, chasteberry and flax seed extract are all active ingredients in helping with the appearance of tight and bright skin.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer over the entire face, or apply to affected areas 1–3 times per day.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eYucca Extract: antioxidant; source of phytoestrogens\u003cbr data-mce-fragment=\"1\"\u003eFlaxseed\/Linseed Extract: Omega 3s, antioxidant\u003cbr data-mce-fragment=\"1\"\u003eHop Extract: antioxidant\u003cbr data-mce-fragment=\"1\"\u003ePaprika: invigorates and rejuvenates the look of skin\u003cbr data-mce-fragment=\"1\"\u003eChasteberry: source of antioxidant bioflavanoids\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eEpidermis appears firmer and tighter\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of skin elasticity is improved\u003cbr data-mce-fragment=\"1\"\u003eSkin appears less oily\u003cbr data-mce-fragment=\"1\"\u003eSkin is more hydrated without appearing oily\u003cbr data-mce-fragment=\"1\"\u003eSkin appears smoother and more silky\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36968004255903,"sku":"","price":52.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/111a-eight-greens-youth-serum-400x400px_0.png?v=1605040829"},{"product_id":"eminence-organics-facial-recovery-oil","title":"Eminence Organics Facial Recovery Oil","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Toning and hydrating oil created with precious herbs and nourishing oils to soothe and renew sensitive and aging skin. This is a luxurious facial oil suitable for all skin types.\\n\\nMade with Biodynamic® ingredients from Demeter International Certified Biodynamic® farms. \\n\\n- Winner of Editor's Choice - Beauty, Beauty Shortlist Awards, 2019\\n- Winner of Favorite Face Oil, Sarah Afshar's Best in Beauty, Beauty Examiner, 2015\\n- Winner of Best Face Treatment Oil, Product Awards, Spa Professional Mexico, 2015\\n- Winner in the Anti-Aging Oil Category, Earth Day Beauty Awards, Healing Lifestyles \u0026amp; Spas, 2014\\n- Winner of Best Green Product, LNE's Best, Les Nouvelles Esthétiques \u0026amp; Spa, 2013\\n\\nHow to Use:\\nAdd 2-3 drops to face and neck with circular motions working your way from the center to the sides of the face.\\n\\nKey Ingredients:\\n\\nClary Sage Oil: calming; balances oil production\\nOlive Oil: calms and soothes the look of skin while deeply hydrating the skin\\nSage Leaf Extract: antioxidant; rejuvenates and tones the look of skin\\nYlang Ylang: cleanser; calming and balancing\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin appears deeply nourished and hydrated\\nSkin appears smoother and softer\\nEpidermis appears regenerated, healing is augmented\\nComplexion appears even \\n\\nEminence Organics is constantly innovating our product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eToning and hydrating oil created with precious herbs and nourishing oils to soothe and renew sensitive and aging skin. This is a luxurious facial oil suitable for all skin types.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eMade with Biodynamic® ingredients from Demeter International Certified Biodynamic® farms. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Editor's Choice - Beauty, Beauty Shortlist Awards, 2019\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Favorite Face Oil, Sarah Afshar's Best in Beauty, Beauty Examiner, 2015\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Face Treatment Oil, Product Awards, Spa Professional Mexico, 2015\u003cbr data-mce-fragment=\"1\"\u003e- Winner in the Anti-Aging Oil Category, Earth Day Beauty Awards, Healing Lifestyles \u0026amp; Spas, 2014\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Green Product, LNE's Best, Les Nouvelles Esthétiques \u0026amp; Spa, 2013\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eAdd 2-3 drops to face and neck with circular motions working your way from the center to the sides of the face.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eClary Sage Oil: calming; balances oil production\u003cbr data-mce-fragment=\"1\"\u003eOlive Oil: calms and soothes the look of skin while deeply hydrating the skin\u003cbr data-mce-fragment=\"1\"\u003eSage Leaf Extract: antioxidant; rejuvenates and tones the look of skin\u003cbr data-mce-fragment=\"1\"\u003eYlang Ylang: cleanser; calming and balancing\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eSkin appears deeply nourished and hydrated\u003cbr data-mce-fragment=\"1\"\u003eSkin appears smoother and softer\u003cbr data-mce-fragment=\"1\"\u003eEpidermis appears regenerated, healing is augmented\u003cbr data-mce-fragment=\"1\"\u003eComplexion appears even \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating our product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36968012710047,"sku":"","price":98.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/113a-facial-recovery-oil-400x400px.png?v=1605040894"},{"product_id":"eminence-organics-firm-skin-acai-booster-serum","title":"Eminence Organics Firm Skin Acai Booster-Serum","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Reduce the signs of aging with this antioxidant-rich extra strength serum and product enhancer infused with acai and naturally derived hyaluronic acid from marshmallow plant.\\n\\nRetail Size: 1 oz \/ 30 ml\\n\\nHow to Use:\\nApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\\n\\nKey Ingredients:\\nAcai Berry: antioxidant rich, nourishing to improve the look of skin tone\\nBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\\nWild Jujube: toning; skin brightener high in Vitamin C to reduce the appearance of signs of aging\\nMaral Root: rich in Vitamin C to improve the appearance of skin\\nHomeostatine® (Marine Algae, Tara Tree): antioxidant; helps to prevent dehydration; reduces the appearance of wrinkle depth\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe visible signs of aging are reduced\\nSkin appears soft and noticeably smoother\\nSkin is hydrated and appears plump\\nSkin appears firmed and revitalized\\n\\nResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eReduce the signs of aging with this antioxidant-rich extra strength serum and product enhancer infused with acai and naturally derived hyaluronic acid from marshmallow plant.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer over the entire face, or apply to affected areas 1–3 times per day. Alternatively, combine 2-3 drops with an Eminence masque or moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eAcai Berry: antioxidant rich, nourishing to improve the look of skin tone\u003cbr data-mce-fragment=\"1\"\u003eBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eWild Jujube: toning; skin brightener high in Vitamin C to reduce the appearance of signs of aging\u003cbr data-mce-fragment=\"1\"\u003eMaral Root: rich in Vitamin C to improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003eHomeostatine® (Marine Algae, Tara Tree): antioxidant; helps to prevent dehydration; reduces the appearance of wrinkle depth\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe visible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin appears soft and noticeably smoother\u003cbr data-mce-fragment=\"1\"\u003eSkin is hydrated and appears plump\u003cbr data-mce-fragment=\"1\"\u003eSkin appears firmed and revitalized\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36968022671519,"sku":"","price":69.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/115a-firm-skin-acai-booster-serum-400x400px.png?v=1605040970"},{"product_id":"eminence-organics-firm-skin-acai-cleanser","title":"Eminence Organics Firm Skin Acai Cleanser","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;Antioxidant-rich acai berries are perfect for revitalizing mature skin. This cream cleanser also blends hyaluronic acid and seabuckthorn oil to restore the appearance of elasticity to the skin and present a more youthful look. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\\n\\nRetail Size: 8.4 oz \/ 250 ml\\n\\nHow to Use:\\nMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage into skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\\n\\nKey Ingredients:\\nAcai Berry Juice: antioxidant; phytonutrient and rich in vitamin content; nourishes and moisturizes to improve skin tone\\nBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smooths and plumps skin to minimize the appearance of fine lines and wrinkles\\nBlueberry Juice: nutrient, antioxidant\\nRaspberry Juice: antioxidant; source of vitamin C and bioflavonoids\\nSeabuckthorn Berry: vitamin and nutrient-rich; protects skin's moisture barrier and fights the look of wrinkles\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe skin is perfectly cleansed and appears balanced\\nReduction in the appearance of visible signs of aging\\nSkin is left feeling hydrated and noticeably smoother\\nSkin feels firmed and revitalized\\n\\nResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eAntioxidant-rich acai berries are perfect for revitalizing mature skin. This cream cleanser also blends hyaluronic acid and seabuckthorn oil to restore the appearance of elasticity to the skin and present a more youthful look. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 8.4 oz \/ 250 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eMix (dilute) a small amount of the product (pea size) with water in hands, apply and massage into skin with fingertips in a circular motion covering the face and neck for 1–3 minutes. Completely remove with a damp face cloth and then finish with an application of toner.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eAcai Berry Juice: antioxidant; phytonutrient and rich in vitamin content; nourishes and moisturizes to improve skin tone\u003cbr data-mce-fragment=\"1\"\u003eBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smooths and plumps skin to minimize the appearance of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBlueberry Juice: nutrient, antioxidant\u003cbr data-mce-fragment=\"1\"\u003eRaspberry Juice: antioxidant; source of vitamin C and bioflavonoids\u003cbr data-mce-fragment=\"1\"\u003eSeabuckthorn Berry: vitamin and nutrient-rich; protects skin's moisture barrier and fights the look of wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe skin is perfectly cleansed and appears balanced\u003cbr data-mce-fragment=\"1\"\u003eReduction in the appearance of visible signs of aging\u003cbr data-mce-fragment=\"1\"\u003eSkin is left feeling hydrated and noticeably smoother\u003cbr data-mce-fragment=\"1\"\u003eSkin feels firmed and revitalized\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36968028733599,"sku":"","price":57.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/116a-firm_skin_acai_cleanser400pix.jpg?v=1605041018"},{"product_id":"eminence-organics-firm-skin-acai-masque","title":"Eminence Organics Firm Skin Acai Masque","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"This mask’s unique combination of acai, blueberry, raspberry and blackberry feeds your skin and keeps it looking healthy. Powered by phytonutrients and antioxidants, the Firm Skin Acai Masque plumps and regenerates your skin for an ageless appearance.\\n\\nRetail Size: 2 oz \/ 60 ml\\n\\nHow to Use:\\nEmulsify a small amount of mask in your hand with a few drops of water. Apply evenly over the entire face as well as the neck and décolleté areas if desired. Allow mask to dry 5–10 minutes then gently scrub off in a circular motion with a lukewarm face cloth. Rinse thoroughly with clear water.\\n\\nKey Ingredients:\\nAcai Berry: nourishing with high antioxidant and vitamin content to improve skin tone appearance\\nBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\\nBlueberry: nutrient, antioxidant\\nRaspberry: antioxidant; source of vitamin C and bioflavonoids while fighting free radicals\\nBlackberry Juice: rich in vitamins C and A; source of antioxidants\\nSeabuckthorn Oil: vitamin rich, nutrient rich; moisturizes to protect skin cell membrane\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe appearance of visible signs of aging are reduced\\nSkin appears plumped and hydrated\\nSkin is left soft and appears noticeably smoother\\nSkin appears firmed and revitalized\\n\\nResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eThis mask’s unique combination of acai, blueberry, raspberry and blackberry feeds your skin and keeps it looking healthy. Powered by phytonutrients and antioxidants, the Firm Skin Acai Masque plumps and regenerates your skin for an ageless appearance.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eEmulsify a small amount of mask in your hand with a few drops of water. Apply evenly over the entire face as well as the neck and décolleté areas if desired. Allow mask to dry 5–10 minutes then gently scrub off in a circular motion with a lukewarm face cloth. Rinse thoroughly with clear water.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eAcai Berry: nourishing with high antioxidant and vitamin content to improve skin tone appearance\u003cbr data-mce-fragment=\"1\"\u003eBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBlueberry: nutrient, antioxidant\u003cbr data-mce-fragment=\"1\"\u003eRaspberry: antioxidant; source of vitamin C and bioflavonoids while fighting free radicals\u003cbr data-mce-fragment=\"1\"\u003eBlackberry Juice: rich in vitamins C and A; source of antioxidants\u003cbr data-mce-fragment=\"1\"\u003eSeabuckthorn Oil: vitamin rich, nutrient rich; moisturizes to protect skin cell membrane\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of visible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin appears plumped and hydrated\u003cbr data-mce-fragment=\"1\"\u003eSkin is left soft and appears noticeably smoother\u003cbr data-mce-fragment=\"1\"\u003eSkin appears firmed and revitalized\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36968044986527,"sku":"","price":69.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/118a-firm_skin_acai_masque.jpg?v=1605041106"},{"product_id":"eminence-organics-firm-skin-acai-moisturizer","title":"Eminence Organics Firm Skin Acai Moisturizer","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Hydrate and nourish aging skin with rich shea butter and skin-plumping botanical hyaluronic acid. Targeted formulas Homeostatine® and Biocomplex boost the appearance of elasticity for younger-looking skin.\\n\\nRetail Size: 2 oz \/ 60 ml \\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\\n\\nKey Ingredients:\\nAcai Berry Juice: nourishing to improve the appearance of skin tone\\nBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\\nBlueberry Juice: nutrient, antioxidant\\nRaspberry Juice: antioxidant; source of vitamin C and bioflavonoids\\nShea Butter: moisturizer; high in triglycerides and fatty acids, it is an excellent emollient for skin that revitalizes and repairs\\nSeabuckthorn Berry Oil: vitamin-rich, nutrient-rich; moisturizes to protect skin cell membrane\\nHomeostatine (Marine Algae, Tara Tree): antioxidant; helps to prevent dehydration; reduces the appearance of wrinkle depth\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe visible signs of aging are reduced\\nSkin appears plumped and hydrated\\nSkin appears soft and noticeably smoother\\nSkin appears firmed and revitalized\\n\\nResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eHydrate and nourish aging skin with rich shea butter and skin-plumping botanical hyaluronic acid. Targeted formulas Homeostatine® and Biocomplex boost the appearance of elasticity for younger-looking skin.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area. Leave on. For a lighter application, emulsify a small amount of moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eAcai Berry Juice: nourishing to improve the appearance of skin tone\u003cbr data-mce-fragment=\"1\"\u003eBotanical Hyaluronic Acid (from marshmallow plant extract): deeply hydrating; natural substance that smoothes and plumps skin to minimize the appearance of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBlueberry Juice: nutrient, antioxidant\u003cbr data-mce-fragment=\"1\"\u003eRaspberry Juice: antioxidant; source of vitamin C and bioflavonoids\u003cbr data-mce-fragment=\"1\"\u003eShea Butter: moisturizer; high in triglycerides and fatty acids, it is an excellent emollient for skin that revitalizes and repairs\u003cbr data-mce-fragment=\"1\"\u003eSeabuckthorn Berry Oil: vitamin-rich, nutrient-rich; moisturizes to protect skin cell membrane\u003cbr data-mce-fragment=\"1\"\u003eHomeostatine (Marine Algae, Tara Tree): antioxidant; helps to prevent dehydration; reduces the appearance of wrinkle depth\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe visible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin appears plumped and hydrated\u003cbr data-mce-fragment=\"1\"\u003eSkin appears soft and noticeably smoother\u003cbr data-mce-fragment=\"1\"\u003eSkin appears firmed and revitalized\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults are enhanced when using entire Firm Skin VitaSkin™ Solution.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36968050557087,"sku":"","price":74.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/119a--firm-skin-acai-moisturizer-400x400px.png?v=1605041141"},{"product_id":"eminence-organics-herbal-eye-make-up-remover","title":"Eminence Organics Herbal Eye Make-up Remover","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"This pH-balanced make-up remover uses cucumber, lavender, calendula and chamomile to gently soothe even the most sensitive eyes. \\n\\nRetail Size: 5.07 oz \/ 150 ml\\n\\n- Winner of Best Makeup Remover, DaySpa Professional Choice Awards, 2017\\n\\nHow to Use:\\nSaturate a cotton ball or pad with product and gently wipe over closed eyelids until all make-up has been removed. In case of direct eye contact, rinse eyes with cool water.\\n\\nKey Ingredients:\\nCalendula Flower Extract: gently soothes, cleans, disinfects, and moisturizes the skin.\\nCucumber Extract: revitalizes and tones\\nComfrey Extract: source of vitamin E; gently lubricates and improves the look of elasticity\\nGreen Tea Extract: antioxidant, phenol and vitamin C-rich\\nChamomile Extract: revitalizes, calms and balances the skin\\nLavender Extract: calms the appearance of irritated skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nEye area is perfectly cleansed\\nEye area appears refreshed and revitalized\\nPuffiness appears reduced and decongested\\nEye area is protected with antioxidant-rich herbs\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eThis pH-balanced make-up remover uses cucumber, lavender, calendula and chamomile to gently soothe even the most sensitive eyes. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 5.07 oz \/ 150 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Makeup Remover, DaySpa Professional Choice Awards, 2017\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eSaturate a cotton ball or pad with product and gently wipe over closed eyelids until all make-up has been removed. In case of direct eye contact, rinse eyes with cool water.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eCalendula Flower Extract: gently soothes, cleans, disinfects, and moisturizes the skin.\u003cbr data-mce-fragment=\"1\"\u003eCucumber Extract: revitalizes and tones\u003cbr data-mce-fragment=\"1\"\u003eComfrey Extract: source of vitamin E; gently lubricates and improves the look of elasticity\u003cbr data-mce-fragment=\"1\"\u003eGreen Tea Extract: antioxidant, phenol and vitamin C-rich\u003cbr data-mce-fragment=\"1\"\u003eChamomile Extract: revitalizes, calms and balances the skin\u003cbr data-mce-fragment=\"1\"\u003eLavender Extract: calms the appearance of irritated skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eEye area is perfectly cleansed\u003cbr data-mce-fragment=\"1\"\u003eEye area appears refreshed and revitalized\u003cbr data-mce-fragment=\"1\"\u003ePuffiness appears reduced and decongested\u003cbr data-mce-fragment=\"1\"\u003eEye area is protected with antioxidant-rich herbs\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36968134344863,"sku":"","price":39.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/124a-herbal-eye-makeup-remover-400x400.jpg?v=1605041817"},{"product_id":"eminence-organics-lavender-age-corrective-night-concentrate","title":"Eminence Organics Lavender Age Corrective Night Concentrate","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Hydrate and replenish your skin’s appearance with this overnight treatment. Rich argan oil, jojoba oil and shea butter improve the look of your skin’s density and aid in reducing the appearance of wrinkles. \\n\\nRetail Size: 1.2 oz \/ 35 ml\\n\\n- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\\n- Winner of Best Stem Cell Product, Product Awards, Spa \u0026amp; Wellness Mexicaribe, 2017\\n\\nHow to Use:\\nApply a thin layer to cleansed skin once or twice daily. Massage in a circular motion. Leave on. Follow with a moisturizer.\\n\\nKey Ingredients:\\nLavender: soothes and softens the look of skin by replenishing moisture\\nArgan Stem Cell Complex (Argan Stem Cells and Nutmeg Seed): contains PhytoCellTec™ Argan stem cells and Nutmeg Seed; results in smoother looking skin\\nArgan Oil: antioxidant; softens and moisturizes\\nEvening Primrose Oil: moisturizes\\nShea Butter:  moisturizes and revitalizes the look of skin\\nJojoba Oil: supports and hydrates the look of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nWrinkles appear filled, skin appears firmer\\nThe appearance of elasticity is improved\\nThe visible signs of aging are reduced\\nSkin appears and feels smooth\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eHydrate and replenish your skin’s appearance with this overnight treatment. Rich argan oil, jojoba oil and shea butter improve the look of your skin’s density and aid in reducing the appearance of wrinkles. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1.2 oz \/ 35 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Stem Cell Product, Product Awards, Spa \u0026amp; Wellness Mexicaribe, 2017\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer to cleansed skin once or twice daily. Massage in a circular motion. Leave on. Follow with a moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eLavender: soothes and softens the look of skin by replenishing moisture\u003cbr data-mce-fragment=\"1\"\u003eArgan Stem Cell Complex (Argan Stem Cells and Nutmeg Seed): contains PhytoCellTec™ Argan stem cells and Nutmeg Seed; results in smoother looking skin\u003cbr data-mce-fragment=\"1\"\u003eArgan Oil: antioxidant; softens and moisturizes\u003cbr data-mce-fragment=\"1\"\u003eEvening Primrose Oil: moisturizes\u003cbr data-mce-fragment=\"1\"\u003eShea Butter:  moisturizes and revitalizes the look of skin\u003cbr data-mce-fragment=\"1\"\u003eJojoba Oil: supports and hydrates the look of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eWrinkles appear filled, skin appears firmer\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of elasticity is improved\u003cbr data-mce-fragment=\"1\"\u003eThe visible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin appears and feels smooth\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36990933401759,"sku":"","price":79.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/131a-lavender-age-corrective-night-concentrate-400x400.jpg?v=1605200310"},{"product_id":"eminence-organics-lavender-age-corrective-night-eye-cream","title":"Eminence Organics Lavender Age Corrective Night Eye Cream","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"This rich, nourishing eye cream will help diminish the visible signs of aging overnight. Lavender and evening primrose provide aromatherapy benefits while the unique Anti-Aging Stem Cell Complex fight the appearance of crow’s feet and leaves skin looking radiant.\\n\\nRetail Size: 1.05 oz \/ 30 ml\\n\\n- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\\n- Winner of Best Eye Cream, Beauty Awards, Natural Health Magazine 2013\\n\\nHow to Use:\\nApply a thin layer to cleansed eye area at night, patting gently with fingertips until fully absorbed. For extra hydration, apply during the day as well.\\n\\nKey Ingredients:\\nLavender: soothes and softens the skin by replenishing moisture\\nArgan Stem Cell Complex (Argan Stem Cells and Nutmeg Seed): contains PhytoCellTec™ Argan stem cells and Nutmeg Seed; results in smoother looking skin\\nArgan Oil: antioxidant; softens and moisturizes\\nEvening Primrose Oil: moisturizes\\nShea Butter: moisturizes and revitalizes the look of the skin\\nCalendula Oil: antioxidant; relieves the appearance of dry skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe appearance of fine lines are reduced, skin appears firmer\\nEye area moisture levels are balanced\\nThe visible signs of aging appear reduced\\nSkin looks and feels smooth\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eThis rich, nourishing eye cream will help diminish the visible signs of aging overnight. Lavender and evening primrose provide aromatherapy benefits while the unique Anti-Aging Stem Cell Complex fight the appearance of crow’s feet and leaves skin looking radiant.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1.05 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Eye Cream, Beauty Awards, Natural Health Magazine 2013\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer to cleansed eye area at night, patting gently with fingertips until fully absorbed. For extra hydration, apply during the day as well.\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eLavender: soothes and softens the skin by replenishing moisture\u003cbr data-mce-fragment=\"1\"\u003eArgan Stem Cell Complex (Argan Stem Cells and Nutmeg Seed): contains PhytoCellTec™ Argan stem cells and Nutmeg Seed; results in smoother looking skin\u003cbr data-mce-fragment=\"1\"\u003eArgan Oil: antioxidant; softens and moisturizes\u003cbr data-mce-fragment=\"1\"\u003eEvening Primrose Oil: moisturizes\u003cbr data-mce-fragment=\"1\"\u003eShea Butter: moisturizes and revitalizes the look of the skin\u003cbr data-mce-fragment=\"1\"\u003eCalendula Oil: antioxidant; relieves the appearance of dry skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of fine lines are reduced, skin appears firmer\u003cbr data-mce-fragment=\"1\"\u003eEye area moisture levels are balanced\u003cbr data-mce-fragment=\"1\"\u003eThe visible signs of aging appear reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin looks and feels smooth\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36990982586527,"sku":"","price":89.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/132a-lavender-age-corrective-night-eye-cream-400x400.jpg?v=1605200535"},{"product_id":"eminence-organics-lime-refresh-tonique","title":"Eminence Organics Lime Refresh Tonique","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"A refreshing and balancing toner for all skin types, particularly normal to oily skin. It is rich in vitamin C to tone and balance the skin’s appearance. Cruelty-free and formulated without parabens, sodium lauryl sulfates, animal by-products, synthetic dyes, petrochemicals, phthalates, GMOs and triclosan.\\n\\nRetail Size: 4.2 oz \/ 125 ml\\n\\nHow to Use:\\nSpray directly on to face and neck, avoiding the eye area. Leave on. May also be applied with cotton pads.\\n\\nKey Ingredients:\\nLime Juice: contains vitamins and antioxidants to act as an astringent, and helps minimize the look of pores\\nGreen Tea: high in antioxidants, polyphenols, flavonoids, and vitamins for youthful-looking skin\\nLavender: heals dry skin and restores moisture\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe skin appears toned and balanced\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eA refreshing and balancing toner for all skin types, particularly normal to oily skin. It is rich in vitamin C to tone and balance the skin’s appearance. Cruelty-free and formulated without parabens, sodium lauryl sulfates, animal by-products, synthetic dyes, petrochemicals, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 4.2 oz \/ 125 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eSpray directly on to face and neck, avoiding the eye area. Leave on. May also be applied with cotton pads.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eLime Juice: contains vitamins and antioxidants to act as an astringent, and helps minimize the look of pores\u003cbr data-mce-fragment=\"1\"\u003eGreen Tea: high in antioxidants, polyphenols, flavonoids, and vitamins for youthful-looking skin\u003cbr data-mce-fragment=\"1\"\u003eLavender: heals dry skin and restores moisture\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe skin appears toned and balanced\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991048253599,"sku":"","price":49.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/138a-lime-refresh-tonique-400x400px.png?v=1605200877"},{"product_id":"eminence-organics-linden-calendula-treatment","title":"Eminence Organics Linden Calendula Treatment","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Use this treatment cream either as a masque or as a night treatment. The extracts derived from fresh linden and calendula plants deeply nourish and refresh the skin’s appearance, and fine herbal oils restore the look of youthfulness and elasticity.\\n\\nRetail Size: 2 oz \/ 60 ml\\n\\nHow to Use:\\nApply a thin layer of the product with fingertips to cleansed skin, avoiding the eye area, or massage in. (Dilute the treatment for a lighter application). Leave on for 5 minutes or longer, or massage in. Remove with a damp face cloth.\\n\\nKey Ingredients:\\nLinden: supports and hydrates the skin’s appearance\\nCalendula: tones, tightens and supports the look of skin through moisturization\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe visible signs of aging are reduced\\nEpidermis appears revitalized and moisturized\\nComplexion appears enriched and radiant\\nSkin surface appears softer and smoother\\n\\nEminence Organics is constantly innovating our product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eUse this treatment cream either as a masque or as a night treatment. The extracts derived from fresh linden and calendula plants deeply nourish and refresh the skin’s appearance, and fine herbal oils restore the look of youthfulness and elasticity.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer of the product with fingertips to cleansed skin, avoiding the eye area, or massage in. (Dilute the treatment for a lighter application). Leave on for 5 minutes or longer, or massage in. Remove with a damp face cloth.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eLinden: supports and hydrates the skin’s appearance\u003cbr data-mce-fragment=\"1\"\u003eCalendula: tones, tightens and supports the look of skin through moisturization\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe visible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eEpidermis appears revitalized and moisturized\u003cbr data-mce-fragment=\"1\"\u003eComplexion appears enriched and radiant\u003cbr data-mce-fragment=\"1\"\u003eSkin surface appears softer and smoother\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating our product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991056609439,"sku":"","price":75.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/140a-linden-calendula-treatment-400x400.jpg?v=1605200945"},{"product_id":"eminence-organics-mangosteen-daily-resurfacing-cleanser","title":"Eminence Organics Mangosteen Daily Resurfacing Cleanser","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Extend the benefits of a treatment or peel at home with a resurfacing cleanser. This milky gel lightly lathers to slough off dead skin without manual exfoliation or over-stripping. The Lactic Acid Complex and mangosteen in this cleanser work together to restore a smooth, radiant complexion.\\n\\nRetail Size: 4.2 oz \/ 125 ml\\n\\n- Winner of Best Exfoliating Cleanser, Beauty Shortlist Awards, 2019\\n- Winner of Best Gel Cleanser, Spa \u0026amp; Wellness Mexicaribe Product Awards, 2018\\n\\nHow to Use:\\nMix a small amount of product with water in hands, apply and massage gently with fingertips in a circular motion covering the face and neck areas. Rinse thoroughly and pat dry. Do not use on broken or abraded skin.\\n\\nKey Ingredients:\\nMangosteen: A super fruit that helps protect skin from drying environmental stressors while promoting natural radiance\\nLactic Acid Complex (Lactic Acid, Ribose, Red Clover Flower Extract): A proprietary blend of actives; gently resurfaces skin and refines pores for a more luminous, even, and youthful looking complexion\\nLactic Acid: Gentle alpha-hydroxy-acid (AHA) exfoliant; removes buildup and improves skin hydration for a brighter, smoother complexion\\nRibose (from Corn Seeds): promotes the look of smoother, revitalized skin\\nRed Clover Flower Extract: refines and improves skin tone to minimize pore size\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nThe skin feels fresh and perfectly cleansed\\nSurface buildup, impurities and blockages are removed\\nPore size is minimized\\nThe complexion looks clear, smooth and radiant\\n\\nEminence Organics is constantly innovating our product formulations to deliver the best results.\\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eExtend the benefits of a treatment or peel at home with a resurfacing cleanser. This milky gel lightly lathers to slough off dead skin without manual exfoliation or over-stripping. The Lactic Acid Complex and mangosteen in this cleanser work together to restore a smooth, radiant complexion.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 4.2 oz \/ 125 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Exfoliating Cleanser, Beauty Shortlist Awards, 2019\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Gel Cleanser, Spa \u0026amp; Wellness Mexicaribe Product Awards, 2018\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eMix a small amount of product with water in hands, apply and massage gently with fingertips in a circular motion covering the face and neck areas. Rinse thoroughly and pat dry. Do not use on broken or abraded skin.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eMangosteen: A super fruit that helps protect skin from drying environmental stressors while promoting natural radiance\u003cbr data-mce-fragment=\"1\"\u003eLactic Acid Complex (Lactic Acid, Ribose, Red Clover Flower Extract): A proprietary blend of actives; gently resurfaces skin and refines pores for a more luminous, even, and youthful looking complexion\u003cbr data-mce-fragment=\"1\"\u003eLactic Acid: Gentle alpha-hydroxy-acid (AHA) exfoliant; removes buildup and improves skin hydration for a brighter, smoother complexion\u003cbr data-mce-fragment=\"1\"\u003eRibose (from Corn Seeds): promotes the look of smoother, revitalized skin\u003cbr data-mce-fragment=\"1\"\u003eRed Clover Flower Extract: refines and improves skin tone to minimize pore size\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eThe skin feels fresh and perfectly cleansed\u003cbr data-mce-fragment=\"1\"\u003eSurface buildup, impurities and blockages are removed\u003cbr data-mce-fragment=\"1\"\u003ePore size is minimized\u003cbr data-mce-fragment=\"1\"\u003eThe complexion looks clear, smooth and radiant\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating our product formulations to deliver the best results.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991078858911,"sku":"","price":54.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/144a-mangosteen-daily-resurfacing-cleanser-400pix.jpg?v=1605201132"},{"product_id":"eminence-organics-mangosteen-daily-resurfacing-concentrate","title":"Eminence Organics Mangosteen Daily Resurfacing Concentrate","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Gently resurface and refine pores to refresh the skin’s natural appearance. The mangosteen in this leave-on concentrate promotes radiance while the Lactic Acid Complex removes and prevents buildup.\\n\\nRetail Size: 1.2 oz \/ 35 ml \\n\\nHow to Use:\\nApply one to two pumps to cleansed skin once or twice daily. Leave on. May be followed with a moisturizer.\\n\\nKey Ingredients:\\nMangosteen: A super fruit that helps protect skin from drying environmental stressors while promoting natural radiance\\nLactic Acid Complex (Lactic Acid, Ribose, Red Clover Flower Extract): A proprietary blend of actives; gently resurfaces skin and refines pores for a more luminous, even, and youthful looking complexion\\nLactic Acid: Gentle alpha-hydroxy-acid (AHA) exfoliant; removes surface buildup and improves skin hydration for a brighter, smoother complexion\\nRibose (from Corn Seeds): Promotes the look of smoother, revitalized skin\\nRed Clover Flower Extract: Refines and improves skin tone to minimize pore size\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nDull skin is immediately refreshed and revitalized\\nEvens skin tone and texture for a natural, luminous glow\\nPore size is minimized\\nSkin is more receptive to further treatment\\nSkin feels smooth and silky\\n\\nEminence Organics is constantly innovating our product formulations to deliver the best results.\\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eGently resurface and refine pores to refresh the skin’s natural appearance. The mangosteen in this leave-on concentrate promotes radiance while the Lactic Acid Complex removes and prevents buildup.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1.2 oz \/ 35 ml \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply one to two pumps to cleansed skin once or twice daily. Leave on. May be followed with a moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eMangosteen: A super fruit that helps protect skin from drying environmental stressors while promoting natural radiance\u003cbr data-mce-fragment=\"1\"\u003eLactic Acid Complex (Lactic Acid, Ribose, Red Clover Flower Extract): A proprietary blend of actives; gently resurfaces skin and refines pores for a more luminous, even, and youthful looking complexion\u003cbr data-mce-fragment=\"1\"\u003eLactic Acid: Gentle alpha-hydroxy-acid (AHA) exfoliant; removes surface buildup and improves skin hydration for a brighter, smoother complexion\u003cbr data-mce-fragment=\"1\"\u003eRibose (from Corn Seeds): Promotes the look of smoother, revitalized skin\u003cbr data-mce-fragment=\"1\"\u003eRed Clover Flower Extract: Refines and improves skin tone to minimize pore size\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eDull skin is immediately refreshed and revitalized\u003cbr data-mce-fragment=\"1\"\u003eEvens skin tone and texture for a natural, luminous glow\u003cbr data-mce-fragment=\"1\"\u003ePore size is minimized\u003cbr data-mce-fragment=\"1\"\u003eSkin is more receptive to further treatment\u003cbr data-mce-fragment=\"1\"\u003eSkin feels smooth and silky\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating our product formulations to deliver the best results.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991082856607,"sku":"","price":79.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/145a-mangosteen-daily-resurfacing-concentrate-400x400.jpg?v=1605201171"},{"product_id":"eminence-organics-mangosteen-gel-moisturizer","title":"Eminence Organics Mangosteen Gel Moisturizer","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Reveal a photo-ready complexion with this lightweight gel-cream moisturizer. This unique pore-minimizing, hydrating formula begins as a dewy gel then beautifully melts into the skin for a smooth, matte finish. For best results, layer over the Mangosteen Daily Resurfacing Concentrate.\"}' data-sheets-userformat='{\"2\":4540,\"5\":{\"1\":[{\"1\":2,\"2\":0,\"5\":[null,2,0]},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"6\":{\"1\":[{\"1\":2,\"2\":0,\"5\":[null,2,0]},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"7\":{\"1\":[{\"1\":2,\"2\":0,\"5\":[null,2,0]},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"8\":{\"1\":[{\"1\":2,\"2\":0,\"5\":[null,2,0]},{\"1\":0,\"2\":0,\"3\":3},{\"1\":1,\"2\":0,\"4\":1}]},\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eReveal a photo-ready complexion with this lightweight gel-cream moisturizer. This unique pore-minimizing, hydrating formula begins as a dewy gel then beautifully melts into the skin for a smooth, matte finish. For best results, layer over the Mangosteen Daily Resurfacing Concentrate.\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991085674655,"sku":"","price":79.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/146a-mangosteen-gel-moisturizer-400x400px-compressed.png?v=1605201201"},{"product_id":"eminence-organics-marine-flower-peptide-eye-cream","title":"Eminence Organics Marine Flower Peptide Eye Cream","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Uniquely formulated for the delicate eye area, this ultra-rich eye cream uses naturally derived plant peptides and innovative algae extracts to reduce the visible signs of aging. Suitable for use day and night, this versatile eye cream provides long-lasting hydration and visibly improves the appearance of wrinkles, puffiness, and dark circles.\\n\\nRetail Size: 1.05 oz \/ 30 ml\\n\\n- Winner of Best Eye Product, ASCP Skin Deep Readers’ Choice Awards, 2018 \\n\\nHow to Use:\\nApply to the entire eye area twice daily, patting gently with fingertips until fully absorbed. Leave on.\\n\\nKey Ingredients:\\nSmart Collagen+ Complex: minerals, amino acids and botanicals reveal significantly smoother skin with the appearance of fewer fines lines and wrinkles\\nBotanical Peptides (from Rice Protein): naturally derived for reducing the look of fine lines and wrinkles\\nRed Algae Extract:  nutrient rich and contains vitamins, minerals, and amino-acids for the visible signs of aging.\\nBotanical Hyaluronic Acid (from Beetroot): smooths, plumps and protects skin against trans-epidermal water loss to help maintain long-lasting hydration and minimize the appearance of fine lines and wrinkles\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nLong-lasting ultra-hydration around the delicate eye area\\nThe appearance of dark circles and puffiness are minimized\\nEye area is radiant and revitalized.\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results.\\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eUniquely formulated for the delicate eye area, this ultra-rich eye cream uses naturally derived plant peptides and innovative algae extracts to reduce the visible signs of aging. Suitable for use day and night, this versatile eye cream provides long-lasting hydration and visibly improves the appearance of wrinkles, puffiness, and dark circles.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1.05 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Eye Product, ASCP Skin Deep Readers’ Choice Awards, 2018 \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply to the entire eye area twice daily, patting gently with fingertips until fully absorbed. Leave on.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eSmart Collagen+ Complex: minerals, amino acids and botanicals reveal significantly smoother skin with the appearance of fewer fines lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBotanical Peptides (from Rice Protein): naturally derived for reducing the look of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eRed Algae Extract:  nutrient rich and contains vitamins, minerals, and amino-acids for the visible signs of aging.\u003cbr data-mce-fragment=\"1\"\u003eBotanical Hyaluronic Acid (from Beetroot): smooths, plumps and protects skin against trans-epidermal water loss to help maintain long-lasting hydration and minimize the appearance of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eLong-lasting ultra-hydration around the delicate eye area\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of dark circles and puffiness are minimized\u003cbr data-mce-fragment=\"1\"\u003eEye area is radiant and revitalized.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991099535519,"sku":"","price":129.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/149a-marine-flower-peptide-eye-cream-400x400.jpg?v=1605201340"},{"product_id":"eminence-organics-marine-flower-peptide-serum","title":"Eminence Organics Marine Flower Peptide Serum","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value=\"{\u0026quot;1\u0026quot;:2,\u0026quot;2\u0026quot;:\u0026quot;This easily absorbed, potent gel serum delivers concentrated plant peptides and botanicals to diminish the appearance of fine lines and wrinkles for visibly smoother, plumper and more youthful-looking skin. Ideal for all skin types, especially aging skin, the Smart Collagen+ Complex rejuvenates the look of the complexion while unique algae extracts increase firmness and provide long-lasting hydration.\\n\\nRetail Size: 1 oz \/ 30 ml\\n\\n- Winner of Best Natural and Organic Product, Best Product Awards, LNE \u0026amp; Spa's, 2019\\n- Winner of Best Daily Serum, Beauty Shortlist Awards, 2018\\n\\nHow to Use:\\nApply a thin layer over the entire face, or apply to affected areas 1–3 times per day.\\n\\nKey Ingredients:\\nSmart Collagen+ Complex: minerals, amino acids and botanicals reveal significantly smoother skin with the appearance of fewer fines lines and wrinkles\\nBotanical Peptides (from Rice Protein): naturally derived for reducing the look of fine lines and wrinkles\\nBlue-Green Algae Extract: a natural retinoid-alternative that reduces the look of wrinkles without the side effects\\nRed Algae Extract: nutrient rich and contains vitamins, minerals, and amino-acids for the visible signs of aging.\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nVisibly smoother and more radiant looking skin\\nMoisture and hydration levels are improved\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results.\\n\u0026quot;}\" data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eThis easily absorbed, potent gel serum delivers concentrated plant peptides and botanicals to diminish the appearance of fine lines and wrinkles for visibly smoother, plumper and more youthful-looking skin. Ideal for all skin types, especially aging skin, the Smart Collagen+ Complex rejuvenates the look of the complexion while unique algae extracts increase firmness and provide long-lasting hydration.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Natural and Organic Product, Best Product Awards, LNE \u0026amp; Spa's, 2019\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Daily Serum, Beauty Shortlist Awards, 2018\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer over the entire face, or apply to affected areas 1–3 times per day.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eSmart Collagen+ Complex: minerals, amino acids and botanicals reveal significantly smoother skin with the appearance of fewer fines lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBotanical Peptides (from Rice Protein): naturally derived for reducing the look of fine lines and wrinkles\u003cbr data-mce-fragment=\"1\"\u003eBlue-Green Algae Extract: a natural retinoid-alternative that reduces the look of wrinkles without the side effects\u003cbr data-mce-fragment=\"1\"\u003eRed Algae Extract: nutrient rich and contains vitamins, minerals, and amino-acids for the visible signs of aging.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eVisibly smoother and more radiant looking skin\u003cbr data-mce-fragment=\"1\"\u003eMoisture and hydration levels are improved\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results.\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991106154655,"sku":"","price":125.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/150a-marine-flower-peptide-serum-400x400px.png?v=1605201378"},{"product_id":"eminence-organics-monoi-age-corrective-exfoliating-cleanser","title":"Eminence Organics Monoi Age Corrective Exfoliating Cleanser","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Wash away impurities, remove surface debris and experience smooth skin like never before with this multi-action, exfoliating cleanser infused with exotic monoi. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\\n\\nRetail Size: 8.4 oz \/ 250 ml\\n\\n- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​​\\n- Winner of Best Cleanser, Beauty Shortlist Awards, UK, 2017\\n\\nHow to Use:\\nMix (dilute) a small amount of product (pea size) with water in hands. Apply and massage into the skin with fingertips in a circular motion, covering the face and neck for 1–3 minutes, avoiding the eye area. Completely remove with a damp face cloth and finish with an application of toner.\\n\\nKey Ingredients:\\nNatural Retinol Alternative: skin appears immediately lifted and tightened; contains chicory root oligosaccharides and tara tree gum\\nPhytoCellTec™ Swiss Green Apple Stem Cells: plant stem cell concentrate; promotes elasticity and delays the visible signs of aging\\nMonoi: fragrant Tahitian oil; hydrates and firms the appearance of the skin\\nFinely Ground Olive Seed: gentle manual exfoliant\\nNatural AHA Cocktail (Lemon, Passion Fruit, Grape \u0026amp; Pineapple Extracts): removes dead skin cells naturally\\nBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin is perfectly cleansed and polished\\nSkin is primed for maximum absorption of subsequent products\\nPore size appears minimized for a clear, matte looking complexion\\nSkin appears revitalized, smooth and bright\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eWash away impurities, remove surface debris and experience smooth skin like never before with this multi-action, exfoliating cleanser infused with exotic monoi. Cruelty-free and formulated without parabens, sodium lauryl sulfates, synthetic dyes, petrochemicals, animal by-products, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 8.4 oz \/ 250 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​​\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Cleanser, Beauty Shortlist Awards, UK, 2017\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eMix (dilute) a small amount of product (pea size) with water in hands. Apply and massage into the skin with fingertips in a circular motion, covering the face and neck for 1–3 minutes, avoiding the eye area. Completely remove with a damp face cloth and finish with an application of toner.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eNatural Retinol Alternative: skin appears immediately lifted and tightened; contains chicory root oligosaccharides and tara tree gum\u003cbr data-mce-fragment=\"1\"\u003ePhytoCellTec™ Swiss Green Apple Stem Cells: plant stem cell concentrate; promotes elasticity and delays the visible signs of aging\u003cbr data-mce-fragment=\"1\"\u003eMonoi: fragrant Tahitian oil; hydrates and firms the appearance of the skin\u003cbr data-mce-fragment=\"1\"\u003eFinely Ground Olive Seed: gentle manual exfoliant\u003cbr data-mce-fragment=\"1\"\u003eNatural AHA Cocktail (Lemon, Passion Fruit, Grape \u0026amp; Pineapple Extracts): removes dead skin cells naturally\u003cbr data-mce-fragment=\"1\"\u003eBioComplex: a booster of antioxidants, Coenzyme Q10, and Alpha Lipoic Acid to reduce the appearance of wrinkles and improve the appearance of skin\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eSkin is perfectly cleansed and polished\u003cbr data-mce-fragment=\"1\"\u003eSkin is primed for maximum absorption of subsequent products\u003cbr data-mce-fragment=\"1\"\u003ePore size appears minimized for a clear, matte looking complexion\u003cbr data-mce-fragment=\"1\"\u003eSkin appears revitalized, smooth and bright\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991109300383,"sku":"","price":57.0,"currency_code":"CAD","in_stock":false}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/151a-monoi_age_exfoliating_cleanser400pix.jpg?v=1605201410"},{"product_id":"eminence-organics-monoi-age-corrective-night-cream-for-face-neck","title":"Eminence Organics Monoi Age Corrective Night Cream for Face \u0026 Neck","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"Nourish and replenish your skin’s appearance overnight with this deeply hydrating cream. The wonderful scent of monoi and our exclusive Anti-Aging Stem Cell Complex leaves the skin appearing finer, smoother and more youthful.\\n\\nRetail Size: 2 oz \/ 60 ml\\n\\n- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​​\\n- Winner of Best Night Cream, Beauty with a Conscience Awards, 2016\\n- Winner of Best Night Cream, Earth Day Beauty Awards, Healing Lifestyles \u0026amp; Spas, 2015\\n\\nHow to Use:\\nApply a layer of moisturizer over the entire face and neck area every night. Leave on. For a lighter application, emulsify a small amount of Moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas or use during the day as well.\\n\\nKey Ingredients:\\nMonoi: fragrant Tahitian oil; hydrates and firms the appearance of the skin\\nArgan Stem Cell Complex (Argan Stem Cells and Nutmeg Seed): contains PhytoCellTec™ Argan stem cells and Nutmeg Seed; results in smoother looking skin\\nArgan Oil: antioxidant; softens and moisturizes\\nEvening Primrose Oil: moisturizes\\nShea Butter: moisturizes and revitalizes the look of skin\\nJojoba Oil: supports and hydrates the skin\\nGrape Seed Oil: antioxidant and emollient\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nSkin appears firm\\nAppearance of wrinkles reduced\\nThe appearance of skin elasticity is improved\\nThe signs of aging are visibly reduced\\nSkin looks and feels smooth\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eNourish and replenish your skin’s appearance overnight with this deeply hydrating cream. The wonderful scent of monoi and our exclusive Anti-Aging Stem Cell Complex leaves the skin appearing finer, smoother and more youthful.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 2 oz \/ 60 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​​\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Night Cream, Beauty with a Conscience Awards, 2016\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Night Cream, Earth Day Beauty Awards, Healing Lifestyles \u0026amp; Spas, 2015\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eApply a layer of moisturizer over the entire face and neck area every night. Leave on. For a lighter application, emulsify a small amount of Moisturizer in your hand with a few drops of water. For extra hydration, apply a thicker layer on dry areas or use during the day as well.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eMonoi: fragrant Tahitian oil; hydrates and firms the appearance of the skin\u003cbr data-mce-fragment=\"1\"\u003eArgan Stem Cell Complex (Argan Stem Cells and Nutmeg Seed): contains PhytoCellTec™ Argan stem cells and Nutmeg Seed; results in smoother looking skin\u003cbr data-mce-fragment=\"1\"\u003eArgan Oil: antioxidant; softens and moisturizes\u003cbr data-mce-fragment=\"1\"\u003eEvening Primrose Oil: moisturizes\u003cbr data-mce-fragment=\"1\"\u003eShea Butter: moisturizes and revitalizes the look of skin\u003cbr data-mce-fragment=\"1\"\u003eJojoba Oil: supports and hydrates the skin\u003cbr data-mce-fragment=\"1\"\u003eGrape Seed Oil: antioxidant and emollient\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eSkin appears firm\u003cbr data-mce-fragment=\"1\"\u003eAppearance of wrinkles reduced\u003cbr data-mce-fragment=\"1\"\u003eThe appearance of skin elasticity is improved\u003cbr data-mce-fragment=\"1\"\u003eThe signs of aging are visibly reduced\u003cbr data-mce-fragment=\"1\"\u003eSkin looks and feels smooth\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991117852831,"sku":"","price":84.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/153a-monoi-age-corrective-night-creamr-400x400.jpg?v=1605201483"},{"product_id":"eminence-organics-neroli-age-corrective-hydrating-mist","title":"Eminence Organics Neroli Age Corrective Hydrating Mist","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"A collagen boosting toner with Natural Retinol Alternative and Swiss Green Apple Stem Cells for all skin types, especially mature. Your skin will feel smoother and appear tighter with the energizing boost of fragrant neroli oil. Cruelty-free and formulated without parabens, sodium lauryl sulfates, animal by-products, synthetic dyes, petrochemicals, phthalates, GMOs and triclosan.\\n\\nRetail Size: 4.2 oz \/ 125 ml\\n\\n- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\\n\\nHow to Use:\\nSpray directly on to face and neck, avoiding the eye area. Leave on. May also be applied with cotton pads.\\n\\nKey Ingredients:\\nNeroli Oil: regenerating, refreshing and hydrating; fragrant antiseptic and skin softener\\nCoconut Milk: moisturizing and nourishing; softens the skin’s appearance\\nCoconut Water: moisture and pH balancing, toning; infuses the skin with strengthening electrolytes, Vitamin C, calcium, potassium, phosphorus\\nNatural Retinol Alternative Complex: immediate lifting and tightening agent containing chicory root oligosaccharides and tara tree; collagen boosting, firming and smoothing\\nPhytoCellTec™ Swiss Green Apple Stem Cells: rejuvenating plant stem cell concentrate; maintains the look of skin’s elasticity and regeneration by strengthening cells and delays the visible signs of aging\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \\n\\nOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\\n\\nResults:\\nEpidermis instantly looks firmer and tighter\\nThe skin appears calmed, matte and hydrated\\nThe skin appears perfectly clear, fresh and toned\\nThe skin appears vibrant and revitalized\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results. \\n\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eA collagen boosting toner with Natural Retinol Alternative and Swiss Green Apple Stem Cells for all skin types, especially mature. Your skin will feel smoother and appear tighter with the energizing boost of fragrant neroli oil. Cruelty-free and formulated without parabens, sodium lauryl sulfates, animal by-products, synthetic dyes, petrochemicals, phthalates, GMOs and triclosan.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 4.2 oz \/ 125 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003e- Winner of Best Anti-Aging Collection, ASCP Skin Deep Readers’ Choice Awards, 2018 ​\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use:\u003cbr data-mce-fragment=\"1\"\u003eSpray directly on to face and neck, avoiding the eye area. Leave on. May also be applied with cotton pads.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients:\u003cbr data-mce-fragment=\"1\"\u003eNeroli Oil: regenerating, refreshing and hydrating; fragrant antiseptic and skin softener\u003cbr data-mce-fragment=\"1\"\u003eCoconut Milk: moisturizing and nourishing; softens the skin’s appearance\u003cbr data-mce-fragment=\"1\"\u003eCoconut Water: moisture and pH balancing, toning; infuses the skin with strengthening electrolytes, Vitamin C, calcium, potassium, phosphorus\u003cbr data-mce-fragment=\"1\"\u003eNatural Retinol Alternative Complex: immediate lifting and tightening agent containing chicory root oligosaccharides and tara tree; collagen boosting, firming and smoothing\u003cbr data-mce-fragment=\"1\"\u003ePhytoCellTec™ Swiss Green Apple Stem Cells: rejuvenating plant stem cell concentrate; maintains the look of skin’s elasticity and regeneration by strengthening cells and delays the visible signs of aging\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic®, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testing \u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eOur natural, organic and Biodynamic® ingredients may have slight variations from harvest to harvest.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults:\u003cbr data-mce-fragment=\"1\"\u003eEpidermis instantly looks firmer and tighter\u003cbr data-mce-fragment=\"1\"\u003eThe skin appears calmed, matte and hydrated\u003cbr data-mce-fragment=\"1\"\u003eThe skin appears perfectly clear, fresh and toned\u003cbr data-mce-fragment=\"1\"\u003eThe skin appears vibrant and revitalized\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results. \u003cbr data-mce-fragment=\"1\"\u003e\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991273631903,"sku":"","price":49.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/158a-neroli_age_hydrating_mis400pixt.jpg?v=1605202505"},{"product_id":"eminence-organics-rosehip-triple-c-e-firming-oil","title":"Eminence Organics Rosehip Triple C+E Firming Oil","description":"\u003cstyle type=\"text\/css\" data-mce-fragment=\"1\"\u003e\u003c!--\ntd {border: 1px solid #ccc;}br {mso-data-placement:same-cell;}\n--\u003e\u003c\/style\u003e\n\u003cspan data-sheets-value='{\"1\":2,\"2\":\"The Rosehip Triple C+E Firming Oil is an effective facial treatment comprised of a blend of results-oriented actives and ingredients that provide intense hydration and protection. Designed as a complementary product to the Citrus \u0026amp; Kale Potent C+E Serum, this facial oil fights the signs of aging, smooths wrinkles and hydrates deeply. For use with all skin types.ÿ\\n\\nRetail Size: 1 oz \/ 30 ml\\n\\nWinner ofÿBest New Skincare Launch of 2016,ÿBeauty Shortlist Awards, UK\\n\\nHow to Use\\nApply a thin layer of oil (2?3 drops) to face and neck with circular motions once or twice daily. Leave on. May be followed with a moisturizer.\\n\\nKey Ingredients\\nRosehip Oil: Rich in Vitamins C, E, and beta-carotene and essential fatty acids. Essential fatty acids improve skin?s moisture, tone, texture as well as the look of pigmentation\\nJojoba Oil: Helps in issues with sebum and soothes dry skin\\nSeabuckthorn Oil: A superfruit packed full of powerful antioxidants,ÿvitamins and essential fatty acids. Essential fatty acids promote skin hydration and elasticity, and also helpÿproblem skin\\nRosemary Leaf Extract: Conditions and smooths the skin\\nMilk Thistle: Contains silymarin, a polyphenol. Milk thistle helps maintain hydration in skin and prevents the signs of aging\\n\\nEminence Organics Believes in: Organic, Natural, Biodynamic©, Sustainable, Cruelty Free\\nEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testingÿ\\n\\nResults\\nSkin is firmed and plumped\\nDry skin is soothed and hydrated\\nVisible signs of aging are reduced\\nProtects dry skin from environmental stressors\\n\\nEminence Organics is constantly innovating their product formulations to deliver the best results.ÿ\"}' data-sheets-userformat='{\"2\":4480,\"10\":2,\"11\":3,\"15\":\"arial, sans, sans-serif\"}' data-mce-fragment=\"1\"\u003eThe Rosehip Triple C+E Firming Oil is an effective facial treatment comprised of a blend of results-oriented actives and ingredients that provide intense hydration and protection. Designed as a complementary product to the Citrus \u0026amp; Kale Potent C+E Serum, this facial oil fights the signs of aging, smooths wrinkles and hydrates deeply. For use with all skin types.ÿ\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eRetail Size: 1 oz \/ 30 ml\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eWinner ofÿBest New Skincare Launch of 2016,ÿBeauty Shortlist Awards, UK\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eHow to Use\u003cbr data-mce-fragment=\"1\"\u003eApply a thin layer of oil (2?3 drops) to face and neck with circular motions once or twice daily. Leave on. May be followed with a moisturizer.\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eKey Ingredients\u003cbr data-mce-fragment=\"1\"\u003eRosehip Oil: Rich in Vitamins C, E, and beta-carotene and essential fatty acids. Essential fatty acids improve skin?s moisture, tone, texture as well as the look of pigmentation\u003cbr data-mce-fragment=\"1\"\u003eJojoba Oil: Helps in issues with sebum and soothes dry skin\u003cbr data-mce-fragment=\"1\"\u003eSeabuckthorn Oil: A superfruit packed full of powerful antioxidants,ÿvitamins and essential fatty acids. Essential fatty acids promote skin hydration and elasticity, and also helpÿproblem skin\u003cbr data-mce-fragment=\"1\"\u003eRosemary Leaf Extract: Conditions and smooths the skin\u003cbr data-mce-fragment=\"1\"\u003eMilk Thistle: Contains silymarin, a polyphenol. Milk thistle helps maintain hydration in skin and prevents the signs of aging\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics Believes in: Organic, Natural, Biodynamic©, Sustainable, Cruelty Free\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics says NO to: Parabens, Phthalates, Sodium Lauryl Sulfate, Propylene Glycol, Animal Testingÿ\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eResults\u003cbr data-mce-fragment=\"1\"\u003eSkin is firmed and plumped\u003cbr data-mce-fragment=\"1\"\u003eDry skin is soothed and hydrated\u003cbr data-mce-fragment=\"1\"\u003eVisible signs of aging are reduced\u003cbr data-mce-fragment=\"1\"\u003eProtects dry skin from environmental stressors\u003cbr data-mce-fragment=\"1\"\u003e\u003cbr data-mce-fragment=\"1\"\u003eEminence Organics is constantly innovating their product formulations to deliver the best results.ÿ\u003c\/span\u003e","brand":"Eminence","offers":[{"title":"Default Title","offer_id":36991369085087,"sku":"","price":125.0,"currency_code":"CAD","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0491\/7192\/3103\/products\/175a-rosehip-triple-ce-firming-oil-400x400px_0.png?v=1605203243"}],"url":"https:\/\/urbannestapothecary.com\/collections\/eminence-organic-skin-care.oembed?page=4","provider":"Urban Nest Apothecary","version":"1.0","type":"link"}